KEGG   Sarcophilus harrisii (Tasmanian devil): 100917513Help
Entry
100917513         CDS       T02286                                 

Gene name
GNB2
Definition
guanine nucleotide binding protein (G protein), beta polypeptide 2
Orthology
K04537  
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:shr04014]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:shr04151]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:shr04062]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:shr04724]
Organismal Systems; Nervous system; GABAergic synapse [PATH:shr04727]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:shr04725]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:shr04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:shr04726]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:shr04723]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:shr04713]
Human Diseases; Substance dependence; Morphine addiction [PATH:shr05032]
Human Diseases; Substance dependence; Alcoholism [PATH:shr05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRSFVSGACDASIKLWDVRDSMCRQTFTGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaattggagcagctgagacaggaggctgagcagctccggaatcagatacgggat
gctcggaaagcatgtggggattcaacattgacccagataacagctgggctggaccctgtt
ggaagaatccaaatgagaacaagacggaccctccgtggtcacctggcaaaaatctatgcc
atgcactggggaacagactcaaggctgctggtcagtgcttcacaggatggaaaactcatc
atctgggacagttatactaccaataaggtccatgctatccctctccgatcctcttgggtc
atgacctgtgcctatgcgccttcagggaattttgtggcttgtggggggttagacaacatc
tgctccatctacagcctcaaaacccgagagggcaatgttagggtcagcagagagctgcca
ggccacactggatacctatcctgctgccgcttcttagatgataaccagatcatcactagc
tctggagataccacctgtgccctgtgggatatagaaacaggacagcagacagtgggcttt
gcaggacacagtggggatgtaatgtccctgtctctggctccggatggtcgaagctttgtt
tctggtgcctgtgatgcttccatcaagctgtgggatgttcgggattccatgtgccgtcaa
acttttacaggacatgagtccgacatcaatgctgtggccttctttccaaatggctatgcc
ttcaccacgggctctgatgatgccacatgccgcctctttgaccttcgggctgaccaggaa
ctactcatgtactctcatgacaatatcatctgtggcatcacctcagttgccttctcccga
agtggccggctcctgctggctggctatgatgactttaattgcaacatctgggatgccatg
aaaggcgatcgggcaggtgtccttgctggccatgataaccgcgttagctgtcttggggtg
actgatgatggtatggctgtagccacaggttcctgggactccttcctcaagatctggaat
tag

DBGET integrated database retrieval system