KEGG   Sarcophilus harrisii (Tasmanian devil): 100917749Help
Entry
100917749         CDS       T02286                                 

Gene name
MAPK7
Definition
mitogen-activated protein kinase 7
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
MicroRNAs in cancer
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:shr04010]
Cellular Processes; Cell communication; Gap junction [PATH:shr04540]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:shr04912]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:shr04921]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:shr04722]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:shr05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 779 aa AA seqDB search
MAEPRKEEEDDEEGGTGGRPEAGKAEPPNPAASVAAKNLALLKARSFDVTFEVGDEYEII
ETIGTGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIK
DILKPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQV
IHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHE
YTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMTVLGTPSPSVIQAVGAERVRAYI
QSLPPRQPVPWETVYPGADRQALSLLGSMLRFEPGARISAAAALRHPFLAKYHDPDDEPD
CAPPFDFAFDREALTRERIKEAIVAEIGDFHARREGIRQQIRFQPILQPVAGEQCCPDVE
MPSPRGPGSDCAMESPPPALPPSGPTSNTIDLTSSQPSLPTGDPAPPKKEGAISDNTKAA
LKAALLKSLRNRLKDGPSVPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRQKER
ERKERVVLAGGGPSGDPLAGLVLSDNDRSLLERWTRMAQPPAPPPGPAAPTPPPPAPPLG
PAPQLTGPSPLPATISSGLQAPVTPLPIPQPLVPPPSLPGPTPTGTMPYFPSAPPPSDLG
GSHQAPTSESPDVNLVTQQLSKSQVDDLLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDM
GVADGPHDSQTDSAPLSASLLTDWLEGHGMNPADIESLQREIQMDSPMLLADLPDLQEP
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggccgagccccgaaaggaggaggaggacgatgaggaagggggaactgggggtcgccct
gaggccgggaaggcagagccccccaaccccgccgcctcagtggcggccaagaatctggcg
ctgctcaaagcccgctccttcgacgtgacttttgaggtgggggatgaatacgagatcatc
gagaccatcggtaccggagcttatggggtggtctcttctgcccgccgccgcctcacaggc
cagcaggtagccatcaagaagattcccaatgcttttgatgtagtaaccaatgccaagcgg
accctgagggagctgaagatccttaaacactttaagcatgacaatatcattgccatcaag
gacattctgaagcccactgtgccatatggggaattcaaatctgtttatgttgtcctggac
ttgatggagagtgacttacaccagattatccactcctcccagccactcaccttggagcat
gtacgctacttcttataccagctacttagaggacttaaatatatgcactcagcccaggtg
atccatcgtgacctcaagccctccaacctgctggtgaatgaaaactgtgagctgaaaatt
ggtgactttggcatggcacggggcctttgtacttctccagctgagcatcagtacttcatg
acagaatatgttgctacacgctggtaccgtgcccctgagctcatgctctccctgcatgag
tacacacaggccattgacctgtggtctgtgggatgcatctttggagagatgctggctcga
cgacagctctttccaggcaagaactatgtacatcagcttcagctgatcatgacagtgttg
gggactccatcaccatctgtgatccaggctgtaggagcggagcgagtacgtgcctacatc
caaagtttgcctccacgccaaccagtgccctgggagacagtatacccaggggctgatagg
caagcactgtcacttctaggctccatgctgcgctttgagcctggtgctcgaatctcagct
gcagctgccttgcgccacccctttttagccaagtaccacgaccctgatgatgagccagac
tgtgccccaccttttgattttgcctttgaccgggaggccctaactcgtgaacgaattaaa
gaggccattgtggctgagataggtgattttcatgcccgacgtgagggaattcgccagcag
atccgtttccagcccatattgcagcctgtggctggagaacaatgctgccctgatgttgag
atgcccagtccccgaggacctggttcagattgtgccatggagtcaccacctccagcccta
cctccctctggacctacatccaacaccatagacttgacctcctctcagccttctctaccc
actggagatccagccccacctaaaaaagaaggggccatctcagacaataccaaagctgct
ctcaaggctgccttgctcaagtccttaaggaatcggcttaaagatggtcccagtgtaccc
ctggaggcccctgagccaaggaagccagtcacagcccaagagcggcagagggagcgagaa
gagaagagaaggcggcggcaggagcgagccaaggaacgagagaaacgacagaaggagaga
gaacgcaaagaaagagttgtattggcagggggtggtccctctggtgatcctctggctgga
ctggtgttgagtgacaatgaccgaagcttattagaacgttggactcgcatggcccagcct
ccagctccaccacctggaccagcagcacctacccctccacctcctgctcctcctcttgga
cctgcccctcaacttactggaccctcaccacttccagctactatttcatctggtctccag
gccccagttacacctcttccaatcccccaaccattggttccacctcctagccttcctggt
cccacccctacaggaaccatgccttactttccatctgccccacccccatcagatctaggg
ggatcccatcaggctcccacttcagagtcaccggatgtgaacctggtgactcaacagcta
tctaagtcacaggtggatgacctattgccccctgttttctcgggaaccccaaagggcagt
ggtgctgggtatggagttggctttgatttggaagaatttctcaatcagtcttttgatatg
ggtgtggctgatggacctcatgacagccaaactgactcagccccactatcagcttctctg
cttactgattggctagagggccatgggatgaatccagctgatattgaatctctacaacgg
gagatccagatggactctcctatgctgctggctgacctgcctgaccttcaggagccttga

DBGET integrated database retrieval system