KEGG   Sarcophilus harrisii (Tasmanian devil): 100917755Help
Entry
100917755         CDS       T02286                                 

Definition
glutathione S-transferase P-like
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100917755
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100917755
   00982 Drug metabolism - cytochrome P450
    100917755
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100917755
Enzymes [BR:shr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100917755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 129 aa AA seqDB search
MEQLYGQLPKFADGDFILYQSNAILRYLGRQLGLYGKDNREAALLDIANDGVEDLRLKYG
RLIYQNYISFGDYNLLDLLPIHQILAPGCLDAFPLLSAYVTRLSSRPKLKAFLTSPQHTD
LPINGNGKQ
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggagcagctctatgggcagctccccaagttcgccgacggagacttcatcctttaccag
agcaacgccatcctgagatacctgggccgccagctcgggctctatgggaaggacaaccga
gaagctgcgctcttggacatcgccaatgatggggtagaggatcttcggctcaagtatggt
cgcctcatctaccagaactatatctcttttggggattacaacctgctggacctgctgccg
atccaccagatcctggcccccggctgcctggatgccttccccttgctgtctgcctatgta
acccggctctcctcccgacccaagctcaaggccttcctgacctccccccagcacactgat
ctccccattaatggcaatggcaaacagtga

DBGET integrated database retrieval system