KEGG   Sarcophilus harrisii (Tasmanian devil): 100917755Help
Entry
100917755         CDS       T02286                                 

Gene name
GSTP1
Definition
(RefSeq) glutathione S-transferase pi 1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100917755 (GSTP1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100917755 (GSTP1)
   00982 Drug metabolism - cytochrome P450
    100917755 (GSTP1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100917755 (GSTP1)
  Drug resistance
   01524 Platinum drug resistance
    100917755 (GSTP1)
Enzymes [BR:shr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100917755 (GSTP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
2
AA seq 194 aa AA seqDB search
SAPSPALRPQLYGQLPKFADGDFILYQSNAILRYLGRQLGLYGKDNREAALLDIANDGVE
DLRLKYGRLIYQNYVSASRPGGPGRERPQTWEPLVRAQAASWDPCCCLGPKALGGRERGS
LLLLPHLDISPGISFGDYNLLDLLPIHQILAPGCLDAFPLLSAYVTRLSSRPKLKAFLTS
PQHTDLPINGNGKQ
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
tcagccccttcccccgcgctccgccctcagctctatgggcagctccccaagttcgccgac
ggagacttcatcctttaccagagcaacgccatcctgagatacctgggccgccagctcggg
ctctatgggaaggacaaccgagaagctgcgctcttggacatcgccaatgatggggtagag
gatcttcggctcaagtatggtcgcctcatctaccagaactatgtgagtgccagcaggcct
ggggggccgggcagagagcgaccccagacttgggaacccttagttcgagcccaagcggcc
tcgtgggatccttgttgctgcctcgggcccaaggcgctcggtgggagggaacggggaagc
cttctcctcctaccccatttagatatctctcctgggatctcttttggggattacaacctg
ctggacctgctgccgatccaccagatcctggcccccggctgcctggatgccttccccttg
ctgtctgcctatgtaacccggctctcctcccgacccaagctcaaggccttcctgacctcc
ccccagcacactgatctccccattaatggcaatggcaaacagtga

DBGET integrated database retrieval system