KEGG   Sarcophilus harrisii (Tasmanian devil): 100917755Help
Entry
100917755         CDS       T02286                                 

Gene name
GSTP1
Definition
(RefSeq) glutathione S-transferase P
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100917755 (GSTP1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100917755 (GSTP1)
   00982 Drug metabolism - cytochrome P450
    100917755 (GSTP1)
   00983 Drug metabolism - other enzymes
    100917755 (GSTP1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100917755 (GSTP1)
   05204 Chemical carcinogenesis
    100917755 (GSTP1)
   05225 Hepatocellular carcinoma
    100917755 (GSTP1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100917755 (GSTP1)
  Drug resistance
   01524 Platinum drug resistance
    100917755 (GSTP1)
Enzymes [BR:shr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100917755 (GSTP1)
Transporters [BR:shr02000]
 Other Transporters
  Pores ion channels [TC:1]
   100917755 (GSTP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
2
AA seq 210 aa AA seqDB search
MPPYTITYFPVRGRCEAMRMLLADQGQTWKEDVVTKDMWMKGDLKATCLYGQLPKFADGD
FILYQSNAILRYLGRQLGLYGKDNREAALLDIANDGVEDLRLKYGRLIYQNYDEGKDDYV
KDLPNQLKPFENLLRQNQGGKTFIVGDQISFGDYNLLDLLPIHQILAPGCLDAFPLLSAY
VTRLSSRPKLKAFLTSPQHTDLPINGNGKQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcctccctacaccatcacctacttccctgtccgagggcgatgtgaggccatgaggatg
ctcctggcggaccagggccagacctggaaggaggacgtggtgaccaaggatatgtggatg
aagggggacctcaaggctacttgtctctatgggcagctccccaagttcgccgacggagac
ttcatcctttaccagagcaacgccatcctgagatacctgggccgccagctcgggctctat
gggaaggacaaccgagaagctgcgctcttggacatcgccaatgatggggtagaggatctt
cggctcaagtatggtcgcctcatctaccagaactatgacgaaggcaaggatgattatgtg
aaggacctgcccaaccagctgaagccttttgagaacctgctgaggcagaaccaaggaggc
aaaacctttattgtgggagaccagatctcttttggggattacaacctgctggacctgctg
ccgatccaccagatcctggcccccggctgcctggatgccttccccttgctgtctgcctat
gtaacccggctctcctcccgacccaagctcaaggccttcctgacctccccccagcacact
gatctccccattaatggcaatggcaaacagtga

DBGET integrated database retrieval system