KEGG   Sarcophilus harrisii (Tasmanian devil): 100917903Help
Entry
100917903         CDS       T02286                                 

Gene name
MYL7
Definition
(RefSeq) myosin, light chain 7, regulatory
  KO
K12754  
myosin regulatory light chain 7
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:shr00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100917903 (MYL7)
  Cellular community
   04510 Focal adhesion
    100917903 (MYL7)
   04530 Tight junction
    100917903 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100917903 (MYL7)
Cytoskeleton proteins [BR:shr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100917903 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 148 aa AA seqDB search
MFEQAQIQEFKEAFSCIDQNRDGIISKSDLKETYSQLGRANVPEEELDEMLQEGKGPINF
TVFLTLFGEKLNGTDPEESILSAFRMFDPSGSGVVNKEEFKQLLLTQADKFSPAEVEQMF
SLTPMDLSGNIDYKSLCYIITHGDEKEE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaacaagcacagatccaggaatttaaggaggcattcagttgcattgatcaaaat
cgagatggcatcatcagcaaatcagacctgaaggagacctactctcaactaggaagagca
aatgtgcctgaagaagagttggatgagatgctacaggaaggcaagggcccgatcaacttc
acagtgtttctcacactctttggggagaagctcaatggcactgaccctgaagaatccatc
ctcagcgccttccgcatgtttgaccccagtggcagtggagttgtcaacaaagaagagttt
aagcagctccttctgacccaggcagacaagttctctccagctgaggtggagcaaatgttt
tcattgacacctatggacctgtcaggaaacatcgactacaaatctctgtgctacatcatc
acccatggggatgagaaggaagagtaa

DBGET integrated database retrieval system