KEGG   Sarcophilus harrisii (Tasmanian devil): 100917917Help
Entry
100917917         CDS       T02286                                 

Gene name
SIRT6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100917917 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 395 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDSPEELDRKVWELAQMIQSSSNVVFHTGAGISTSSG
IPDFRGPQGVWTMEEQGLAPKFDITFESARPSKTHMALLQLERVGILKFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDVVVGSMGLKATGRLCTVAKARGLRACRGE
LRDTILDWEDALPDRDLNLADEACRNADLSITLGTSLQIRPSGNLPLLTKRKGGRLVIVN
LQATKHDRQADLRIHGYVDDVMAKLMKHLCLEIPEWQGPLVVERAPPLLPLLKQVKAELP
TLPDLPSAPKTEPPAHRHRPELEGGKREQPPAPRLPKRVKVEPMPSXXXXLNDLPSAPKT
EPPGHRHRPELEGGKREQPPAPRLPKRVKVEPMPS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaactacgcggccgggctctcgccttatgcggataagggcaagtgcgggctc
cccgagatcttcgactcccctgaagagctagacagaaaagtatgggagctggcacagatg
attcagagttcttccaatgtggtatttcacacaggtgcaggtatcagcacttcctcaggc
atcccggacttcaggggtccccagggtgtctggaccatggaggaacagggtctggcaccc
aagtttgacataacatttgagagtgcccggccttctaagacccacatggccctgctgcaa
ctggagcgagtgggcatcctaaagttcctggtgagccagaatgtagatgggttgcacgtg
cgctccggcttccccagggacaaactggctgaactccatgggaacatgtttgtggaagaa
tgtgccaagtgtaagacgcagtatgtacgtgatgtggtggtgggcagcatgggcctcaag
gcaacaggacggttgtgcactgtggcaaaggcccgaggccttcgggcctgcagaggggaa
ctgagagataccatcttggactgggaagatgccctgcctgatcgagacctcaaccttgct
gatgaagcctgcaggaatgccgatctatctattactttgggtacgtcactgcagatccgg
cccagtggcaacctgcctctgctcactaaacgcaaaggaggccgcctggtcatagtcaac
ctgcaagccaccaagcacgaccgccaggctgaccttcgaattcatggctacgtcgatgat
gtcatggccaagctcatgaaacacctgtgcttggagatccctgaatggcaggggcccctt
gtggtggaacgggccccacctctgctgccccttctgaaacaagtgaaggctgagctcccc
accctcccagacctgccctcagcacccaagacagagccccctgcccatcgccacagacca
gagctggaaggtggcaaacgggagcagccccctgccccccggctgcccaagagggtgaag
gtggagcctatgcccagctnnnnnnnnnncctgaatgacctgccctcagcacccaagaca
gagccccctggccatcgccacagaccagagctggaaggtggcaaacgggagcagccccct
gccccccggctgcccaagagggtgaaggtggagcctatgcccagctga

DBGET integrated database retrieval system