KEGG   Sarcophilus harrisii (Tasmanian devil): 100918116Help
Entry
100918116         CDS       T02286                                 

Gene name
IRS1
Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  insulin receptor substrate 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04022  cGMP-PKG signaling pathway
shr04068  FoxO signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04722  Neurotrophin signaling pathway
shr04910  Insulin signaling pathway
shr04920  Adipocytokine signaling pathway
shr04923  Regulation of lipolysis in adipocytes
shr04930  Type II diabetes mellitus
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease (NAFLD)
shr04960  Aldosterone-regulated sodium reabsorption
shr05206  MicroRNAs in cancer
Module
shr_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100918116 (IRS1)
   04022 cGMP - PKG signaling pathway
    100918116 (IRS1)
   04151 PI3K-Akt signaling pathway
    100918116 (IRS1)
   04152 AMPK signaling pathway
    100918116 (IRS1)
   04150 mTOR signaling pathway
    100918116 (IRS1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100918116 (IRS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100918116 (IRS1)
   04923 Regulation of lipolysis in adipocyte
    100918116 (IRS1)
   04920 Adipocytokine signaling pathway
    100918116 (IRS1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100918116 (IRS1)
  Nervous system
   04722 Neurotrophin signaling pathway
    100918116 (IRS1)
  Aging
   04211 Longevity regulating pathway - mammal
    100918116 (IRS1)
   04213 Longevity regulating pathway - multiple species
    100918116 (IRS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100918116 (IRS1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100918116 (IRS1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100918116 (IRS1)
   04931 Insulin resistance
    100918116 (IRS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH PH_11 Spt20
Motif
Other DBs
NCBI-GeneID: 100918116
NCBI-ProteinID: XP_023356569
Position
3
AA seq 1251 aa AA seqDB search
MASPPEGDGCFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSGA
PKRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSESEQESWYQALLQLHNRAKG
HHLHHSHHEAAAFGVGGGGGGGGSCSGSSGLGEAGEDSSYGEMAPGPAFKEVWQVILKPK
GLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVT
GPGEFWMQVDDSVVAQNMHETILEAMRAMSEEFRPRSKSQSSSNCSNPISVPLRRHHLNN
PPPSQVGLTRRSRTESVTATSPASVVGGKPCSFRVRASSDGEGTMSRPASVDGSPVSPST
NRTHSHRHRGSSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRR
SSASVSGSPSDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEDLSNYICMGGK
NPPNLTAPNGHYNLSRSGIVHRYTPGAGPSPATVGDEVATAAELEKSFRKRTHSAGTSPT
ISHQKTPSQSSVASIEEYTEMMPSYPPCSAAGSGNRGQAYRHSAFVPTHSYPEECLEIHP
LEDRGGHHHHRVDTPVLHTDDGYMPMSPGVAPVPSGRKSGGDYMPMSPKSVSAPQQIINP
SRRHSQRVDPNGYMMMSPSGSCSPDSAGGSGSSNTVTSGNSYGKLWTNGVGGHHHHHVHP
KFSVESSDGKLPCSSDYINMSPAGDSVTSSPSDGYYGPDDPQNKAIYSYYSLPRSFKHTQ
QQQQQQQQQQQQQQQXXXXXXXEDGGRLPHLRLSVSSGRLLYATAAEDSSSSASSDSLGG
GGGTQEGAHGHLHHQALPQHLPRKADMVAQTKNRLTRPTRLSLDGPKASTLPRAREQPQQ
PLLPPEPKSPGEYVNIEFVGDQPGYSHGSAISLCSPTVRCPSQRQPAPREDEAGSEEYMN
MDLRPPRRPVCQESFVAKAGRACPLPTGAGGVCRPSRVVPNSQDYVTMQVGGPCPGCADA
SLSYVVMQASKASEEPSVPAAAAPAPSLPFTAAPPSLPQHQGQAELASRPSLLGGPKGPG
GISAFTRVNLSPSRNQSAKVIRADPQGCRRRHSSETFSSTPSASRGSNVAVPFGAAAAGG
SGATGSSEDVKRHSSASFENVWLKPGDVGGPPSRKETSQMSGAAAGLENGLNYIDLDLVK
DFNHRPQECPPLLQPPHQPCGSGGASGNGCSSEDLSAYASISFQKQPEDLP
NT seq 3756 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcccaccggagggggacggctgcttctccgacgtgcggaaggtgggctacctc
cgcaaacccaagagcatgcacaaacgcttcttcgtcctgcgggcggccagtgaggccggg
gggccggcccgcctggagtactatgagaacgagaagaagtggaggcacaaatccggtgcc
cccaagcgctctatcccgctggagagctgtttcaacatcaacaagcgggctgactccaaa
aacaaacacctggtagccctctacacccgggacgagcatttcgccattgccgcggatagc
gagtcggagcaggagagctggtaccaggcgctcctgcagctccacaaccgggccaaggga
catcacttgcaccattcccaccacgaggctgcagcttttggagtgggagggggaggaggc
ggaggggggagctgcagcggcagctctggcctgggagaagccggggaggacagtagctat
ggggaaatggccccaggaccagcattcaaggaggtttggcaagtgatcctgaagcctaag
ggcttggggcagacaaagaacctgattggcatctaccggctctgcctgaccagtaagacc
atcagctttgtgaagctgaactcggaggctgccgcagtggtcctccaactgatgaacatt
cgcaggtgtggtcactccgaaaacttcttttttattgaggtggggcgctctgcggtgact
ggacctggggagttctggatgcaagtggatgattccgtggttgcccagaatatgcacgag
accatcctggaagctatgcgggccatgagtgaggaattccggcctcggagcaagagccag
tcgtcctccaactgctccaaccccatcagcgtacccttacgcaggcatcacctcaataat
ccaccccccagccaggtggggctcacccgcagatcccggactgagagcgtcaccgccaca
tcacccgctagtgtcgtgggtgggaagccctgctctttccgagtccgggcatccagtgat
ggagaaggcaccatgtcccgaccggcctcggtggatgggagtcccgtaagccccagtacc
aaccggactcattcacaccggcatcggggcagctcccgcttgcacccgcccctcaaccac
agccgctccatcccgatgccttcctcccgatgttccccttcggccacgagtccggtcagc
ttatcgtccagcagcaccagtggccacgggtcgacctctgactgtctcttcccaaggagg
tccagtgcttccgtgtccggctcacccagcgatgggggtttcatctcttccgatgaatac
ggctctagcccgtgtgacttccgaagttccttccgcagcgtcactccggattccctgggt
cacaccccaccggccaggggggaagaagatctgagcaactatatctgcatgggaggcaaa
aacccgcctaacttgactgcccccaatggccactataacctatccagaagtggcatcgtg
caccgctataccccgggagctggcccgagtcctgccactgtgggagatgaggtagccact
gctgcagagctggagaagagtttccgcaagagaacacactcagcaggtacttctcctact
atttcccaccagaagacaccttctcagtcctccgtagcatccattgaagagtacacagag
atgatgccttcctacccgccctgttcagcggctggcagtgggaaccggggccaagcctac
cgccactcagcctttgtgcccacccactcctatcctgaggagtgtctggagatccatccc
ttggaggatcggggaggccaccaccatcaccgggtggatactccggtgctacatacagac
gacggctacatgcccatgtctcctggggtggctccggtgcccagtggccgaaagagcggt
ggagattacatgcccatgagccccaagagcgtatctgctccccagcagatcattaacccc
agcaggcgccattcgcagagggtagaccccaatggctacatgatgatgtctcccagtggc
agctgttccccagacagtgcaggtggctctggcagcagcaacacggtcacttctgggaac
agttacggcaagttatggacaaacggggtgggtggccaccaccaccaccacgttcacccg
aagttctctgtggagagcagtgacggcaagctaccttgcagcagcgattacatcaacatg
tcccctgctggggactctgtgaccagcagcccctcagacggttactatggcccagatgat
ccacaaaacaaggccatctactcttactactcattgccaagatccttcaaacacactcag
cagcagcagcagcaacagcagcagcaacagcagcagcagcagcagnnnnnnnnnnnnnnn
nnnnntgaagatggtggccggctccctcacctgcgcctctcggtcagctccggtcgcctc
ctgtacgccactgcagccgaggactcttcctcttctgccagcagtgatagcctgggagga
ggtggaggcacacaggagggggcccatggccatctccatcatcaggccctgccacagcac
ctgccccggaaagcagacatggttgcccagaccaagaatcgcctaacccggcccaccagg
ctgtctctggatggccccaaggccagcaccttgcctagggctagggagcagccacagcag
cctcttctgcccccagagcccaagagccccggagaatatgtgaacattgagtttgtaggg
gaccagccgggctactcccacggctcggccatctccctctgctcgcccacagtcaggtgc
ccatcccagcgacagccggcccccagagaagatgaggctggctcagaggaatacatgaac
atggacttgaggcctcctcggaggcctgtctgtcaggaaagctttgtggcaaaggctggc
agagcatgccccctgcccaccggggcgggtggggtgtgtaggcccagtcgcgtggtgcca
aacagccaggattacgtgaccatgcaggtgggtgggccctgtcctggctgtgcagatgcc
tccctcagctatgtggtcatgcaggcaagcaaggcttcggaggagcccagtgtcccagct
gctgcggctcctgccccttcccttccttttaccgcagcgcccccctctctcccccagcac
caaggacaggcagagctggctagccgcccatccctgttaggaggtccgaagggacccgga
gggattagcgcctttaccagagtgaacctcagtcccagccgcaaccagagtgccaaagtg
atccgggctgacccccaagggtgccggaggcggcacagctcggagaccttttcctccacc
cctagtgcttctcgaggcagtaacgtcgcggtgccctttggggccgctgccgcaggtggc
tctggggccactggcagcagcgaagatgttaaacgccacagttctgcctcctttgaaaat
gtctggctaaagcctggggatgtcgggggcccacccagcaggaaggagacatcccagatg
agcggggctgcagcgggtttagaaaatggactcaactacattgacctggatttggtcaag
gattttaatcaccggccccaggagtgtccccctctgctgcagcctcctcatcagccctgt
ggcagcggcggagccagtgggaacggctgctccagtgaggatctaagcgcctatgcgagc
attagctttcagaagcagcccgaggaccttccatag

DBGET integrated database retrieval system