KEGG   Sarcophilus harrisii (Tasmanian devil): 100918135Help
Entry
100918135         CDS       T02286                                 

Gene name
USP33
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 33
  KO
K11848  ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100918135 (USP33)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100918135 (USP33)
Ubiquitin system [BR:shr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100918135 (USP33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 DUSP zf-UBP
Motif
Other DBs
NCBI-GeneID: 100918135
NCBI-ProteinID: XP_023359625
Ensembl: ENSSHAG00000001467
Position
4
AA seq 910 aa AA seqDB search
MPSVEMPALSSDCPHLESVGEITKENLIQKSLGTCQDCKVRGPNLWACLENRCTYVGCGE
SYVDHSTIHSQETKHYLTVNLTTLRVWCYACTKEVFLERKFGAPASLPQTTRPLSAAPES
VQDFKVPHPTLKTPLAAVFDDLDRDVDEEDELKARGLTGLKNIGNTCYMNAALQALSNCP
PLTQFFLDCGGLARTDKKPAICKSYLKLMTELWHKSRPGSVVPTNLFQGIKTVNPTFRGY
SQQDAQEFLRCLMDLLHEELKEQVMETEDGAPPGPADEAMEDEKSPSEMDFQSCESCGSS
DKADNETGPRGLMEDHMETAMLIQEDENNPSPGMMKEKALGHKVGPKSPEEDMEKDVDTL
SEMVDILNSQETVKVQIHSRLTEHAPDSHSNDHLPLSEGAPRLSTSPPKSSSLWSGTTSG
HKRALPASSPKRKKQQKRYRSVISDIFDGTIVSSVQCLTCDRVSVTLETFQDLSLPIPGK
EDLARLHSASHPTAMVKAGSCGEAYAPQGWIALLVEYLRRFVVSCVPSWFWGPVVTLQDC
LAAFFARDELKGDNMYSCERCKKLRNGVKFCKVQKFPEILCIHLKRFRHELMFSTKISTH
VSFPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASSGHYIAYCRNNLNNLWYEFDDQ
SVTEVSEVTVQNAEAYVLFYRKSSEEAQKERRRVSNLLNIMEPSLLQFYVSRQWLNKFKT
FAEPGPISNQDFLCVHGGVPPRKAGYIEDLVVMLPQNIWDNLYSRYGGGPAVNHLYVCHT
CQIEAEKVEKRRKMELEMFIRLNRAFQEEESPAAFFCISMQWFREWEGFVKGKDGDPPGP
IDNTKIAIIKGGSILLKQGADSGQISEETWHFLQSIYGGGPEVILRPPVAPIDPDALQTE
EKIEVETRAL
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgccttccgttgaaatgccggcactcagcagtgactgtccacatttggagtcagtgggt
gaaataacaaaagaaaatttgatacagaaatctctcggcacttgtcaggactgtaaagtc
cgaggaccaaatctctgggcctgcctagagaaccgatgtacgtatgttggctgtggcgag
tcctacgtagaccacagtactattcactctcaggagacaaagcactatctcaccgtgaac
ctcaccactctccgggtctggtgttatgcctgcaccaaagaagtcttcctggagaggaag
ttcggggcacccgcttccctgccgcagaccacgagaccgctgtccgcagccccggaaagc
gtccaggacttcaaggtgccgcatccaaccctcaagactcctctggctgcagtcttcgat
gatctggacagagatgtggatgaagaggacgagctaaaggcaagaggtctcacgggtttg
aaaaacatcggcaacacttgttacatgaatgcggctctgcaggctctttctaattgtccg
cctttgacccagttcttccttgattgtggaggactggcccgcacggataagaaaccggcc
atctgcaagagctatctcaagctgatgacagagctctggcataagagcaggcctggatct
gttgtcccgaccaatttatttcaaggaattaaaactgtgaacccaacatttcgaggttat
tcccagcaggatgcccaggaattcctccggtgtttaatggacctgcttcatgaggaactc
aaagagcaggtcatggagactgaggatggggcccctcccgggccggctgatgaggccatg
gaggacgagaagagcccctcggagatggacttccagtcgtgtgaatcgtgtgggagcagc
gacaaggctgacaatgaaacgggcccccgcggcctgatggaggaccacatggagaccgcc
atgttaatccaggaggatgagaacaatcccagccccgggatgatgaaggagaaagctctg
ggtcacaaggtgggccccaagagtcccgaggaagacatggagaaagacgtggacaccttg
tcggagatggtggacattctaaacagccaggagaccgtcaaagtgcagatacacagccgg
ctcacagaacatgcgcccgatagtcactccaatgaccatctcccattgagcgaaggagcc
ccacgcttgtccaccagccctcccaagtcgagctccttgtggtcaggaaccacgtccggc
cacaaaagagcgctgccagcctcgtctcccaagaggaagaaacagcaaaagcggtatcgg
agcgtcatttcggacatctttgatgggacgatcgtgagctccgtgcagtgtctgacttgt
gaccgggtgtcggtgactctggagaccttccaggacctgtccctgcccatccccggcaag
gaggacctggcccggctgcactcggcaagccaccccaccgccatggtgaaagcgggctcc
tgtggggaggcgtacgcgccccagggctggatcgccctcctggtggagtacctgcgcagg
tttgttgtctcctgtgtccctagctggttttggggtccagtagtgaccttgcaagattgt
ctcgctgcctttttcgccagagatgagctcaaaggtgacaacatgtacagctgtgaacgg
tgcaaaaaactgagaaatggagtaaagttctgtaaggtgcagaagttccctgagatcttg
tgcatccacctgaagaggttcaggcacgagctcatgttctccaccaagatcagcacccac
gtgtccttccctctcgagggcctggatctccagcccttccttgccaaggacagcccggcc
cagattgtgacctatgacctgctgtcagtcatctgtcaccacggcaccgcaagcagcgga
cactacatcgcctactgccgcaacaatctcaataacctgtggtacgagttcgatgaccag
agcgtgaccgaggtctcggaggtaactgtgcagaatgcagaggcctacgtgcttttctac
aggaagagcagcgaggaggcccagaaggagcgccggcgcgtctccaacctgttgaacatc
atggagccaagcctcctgcagttctacgtctcccggcagtggctgaacaagttcaagacc
ttcgccgagcccggccccatctccaaccaggacttcctctgtgtccacgggggagtcccc
ccacgcaaagccggctacatcgaggacctagtggtgatgctccctcagaacatctgggac
aatttatatagcaggtacgggggaggcccagccgtcaaccacctgtacgtgtgccacacc
tgccagatcgaagccgagaaagtggaaaagagaaggaagatggagctggagatgttcatc
cggctgaaccgagccttccaagaggaggagtccccggccgccttcttctgcatcagcatg
cagtggttccgagagtgggaaggcttcgtcaaggggaaggatggagacccccccgggccc
atcgataacacaaagattgccatcatcaagggtgggagcatcctcctcaaacaaggggcc
gactcggggcagatttccgaagagacgtggcacttcctgcagtccatctatggcgggggc
cccgaggtcatcctgcgtccgcccgtggcccccatcgaccccgacgcgctgcagacggag
gagaagatcgaggtggagacgcgggccctctga

DBGET integrated database retrieval system