KEGG   Sarcophilus harrisii (Tasmanian devil): 100918255Help
Entry
100918255         CDS       T02286                                 

Definition
acyl-CoA desaturase-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100918255
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100918255
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100918255
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100918255
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100918255
Lipid biosynthesis proteins [BR:shr01004]
 Desaturase
  First
   100918255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 363 aa AA seqDB search
MPAHLLQEEISPSYTMTTTTTITAPSSRALQNGATKGASKAPLEKDEEGISYEMRDDMFD
PTYREKDGPKPKFIYVWRNIILMGLLHLGAVYGIFLLPSSHVYTLLWAFGYYLVSALGIT
AGAHRLWSHRTYKARLPLRIILMIANTMAFQNDIFEWSRDHRVHHKFSETDADPHNARRG
FFFSHVGWLLVRKHPDVIEKGRLLDLSDLKSEKLVMFQRRYYKPGILLMCFIFPTFVPCY
FWGESFTHSLFVATLLRYAVVLNATWLVNSAAHMYGTRPYDKNINPRENILVALGAVGEG
FHNYHHTFPYDYSASEYRWHINFTTFFIDCMCLLGLAYDRKKVSKAAIEARCARTGEGSW
KGR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccatttgctacaggaggagatctctccctcctacactatgaccaccacgacc
accatcacagccccttcctccagggctctgcagaacggagcaaccaaaggagcgtcaaaa
gcaccccttgagaaggatgaagaggggatcagctatgagatgcgggacgacatgtttgac
cccacttatcgggagaaggatggtcccaaacccaagttcatctatgtctggaggaacatc
atcctgatgggcctgcttcacttgggagccgtgtatgggatcttcctgctgccttcctct
catgtgtataccttgctctgggcatttgggtactacctggtcagcgccctgggcatcact
gctggagcccaccgcctctggagtcacagaacctacaaggcacgcctgcccctccggatc
attctgatgatcgctaacaccatggccttccagaatgacattttcgagtggtccagggac
caccgtgtccatcataagttctctgagacagatgctgatccccataatgcccgccgtggg
tttttcttctcccatgtgggctggctgctagtgcgcaaacacccagatgtcattgagaag
ggccgtttgcttgacctgtccgatctgaaatctgagaagctggtgatgttccagaggaga
tactacaagcctggcatcctcctcatgtgcttcatattccccacattcgtcccctgttac
ttctggggagaaagttttactcacagcctgtttgttgccaccctcctacggtatgctgtc
gtactgaatgccacctggctggtgaacagcgctgctcatatgtatggcacccggccctat
gacaagaacatcaacccccgagagaatatcttggtggcccttggagctgtaggtgaaggc
ttccacaactaccaccacaccttcccctacgattactccgccagcgaataccgctggcac
atcaatttcaccaccttcttcatcgactgcatgtgtctcctcggcttggcgtacgaccga
aagaaagtctccaaggcagccatcgaggccagatgcgccagaactggtgaagggagctgg
aagggccgctga

DBGET integrated database retrieval system