KEGG   Sarcophilus harrisii (Tasmanian devil): 100918634Help
Entry
100918634         CDS       T02286                                 

Gene name
GBE1
Definition
(RefSeq) glucan (1,4-alpha-), branching enzyme 1
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100918634 (GBE1)
Enzymes [BR:shr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     100918634 (GBE1)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100918634 (GBE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 465 aa AA seqDB search
MAIMEHAYYASFGYQVTSFFAASSRYGTPDELKELVDTAHSMGIIVLLDVVHSHASKNSE
DGLNKFDGTDSCYFHSGPRGNHELWDSRLFAYSRWEVLRFLLSNLRWWLEEYRFDGFRFD
GVTSMLYHHHGMGQGFSGDYNEYFGLQVDEDSLVYLMLANYLVHSVYPDCITIAEDVSGM
PALCCPITQGGGGFDYRLAMAIPDKWIQILKEFKDEDWNMGNIVHTLINRRYLEKCIAYA
ESHDQALVGDKTLAFWLMDAEMYTNMSVLSPLTLVIDRGIQLHKMIRLITHALGGEGYLN
FMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDELLRYKFLNNFDKDMNKLEERFGWL
SAPQAFVSEKHEENKVIAFERANLLFLFNFHPEKSFTDYRVGTASSGKFKIVLDTDEEKY
GGHQRLDHNTDFISESFEHNGRPYSLLVYIPSRVGLVLQNMDIPN
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggctatcatggaacatgcttattatgctagtttcggttatcaagtgacaagttttttt
gcagcatccagtcgttatggcactcctgatgaattgaaagaattggttgacactgctcac
tcaatgggaatcatagttctcttggatgtagttcatagtcatgcatcaaaaaattcagag
gatggtctaaacaaatttgatggaactgattcctgttattttcattctggtcctagagga
aatcatgaactctgggatagtagactatttgcctattccagatgggaagttttaagattc
cttctttctaacttgagatggtggctagaagaatatagatttgatggattccgttttgat
ggcgtgacatccatgctttatcaccaccatggaatgggtcaaggcttttcaggtgattac
aatgaatattttggactacaagtagatgaagattctctggtttatcttatgctggcaaac
tacttggttcattcagtttatccagattgtataacaattgctgaggatgtttcaggaatg
ccagctttgtgctgtcctattactcagggtggaggtggttttgattatcgattagccatg
gcaattccggataaatggatccagatacttaaagaatttaaagatgaagactggaatatg
ggaaacattgtgcataccctcataaacaggcgttaccttgaaaagtgcattgcatatgca
gaaagtcatgatcaggctcttgttggtgataaaaccctggcattctggttgatggatgca
gaaatgtatacaaatatgagtgtgctgtcccctcttactctagttattgatcgtggaata
caacttcataaaatgattcgtctcatcactcatgcgcttggaggggaaggctatctgaac
tttatgggtaatgaatttggccacccagaatggttggactttccaagaaaaggaaataat
gagagctaccattatgctaggagacagtttcatctgactgatgatgaactccttcgctat
aaattcctcaataactttgacaaagatatgaataagttggaagaacgatttggttggctt
tcagcacctcaggcctttgtgagtgaaaaacacgaagaaaataaggttattgcttttgag
agagcaaatcttctttttctcttcaatttccatccagaaaagagttttactgattataga
gtgggaacagcatcatcaggaaaattcaaaattgttctggatactgatgaagagaaatat
ggaggacatcagagattggaccataatacagatttcatttctgagtcttttgaacataat
ggccgtccttattctcttttggtatacattccaagcagagtgggtcttgtgcttcaaaat
atggatataccaaactga

DBGET integrated database retrieval system