KEGG   Sarcophilus harrisii (Tasmanian devil): 100918689Help
Entry
100918689         CDS       T02286                                 

Gene name
PPP3R1
Definition
protein phosphatase 3, regulatory subunit B, alpha
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Apoptosis
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Oxytocin signaling pathway
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Amphetamine addiction
Tuberculosis
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100918689 (PPP3R1)
   04310 Wnt signaling pathway
    100918689 (PPP3R1)
   04370 VEGF signaling pathway
    100918689 (PPP3R1)
   04020 Calcium signaling pathway
    100918689 (PPP3R1)
   04022 cGMP - PKG signaling pathway
    100918689 (PPP3R1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100918689 (PPP3R1)
   04210 Apoptosis
    100918689 (PPP3R1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100918689 (PPP3R1)
   04660 T cell receptor signaling pathway
    100918689 (PPP3R1)
   04662 B cell receptor signaling pathway
    100918689 (PPP3R1)
  Endocrine system
   04921 Oxytocin signaling pathway
    100918689 (PPP3R1)
  Nervous system
   04724 Glutamatergic synapse
    100918689 (PPP3R1)
   04720 Long-term potentiation
    100918689 (PPP3R1)
  Development
   04360 Axon guidance
    100918689 (PPP3R1)
   04380 Osteoclast differentiation
    100918689 (PPP3R1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100918689 (PPP3R1)
   05014 Amyotrophic lateral sclerosis (ALS)
    100918689 (PPP3R1)
  Substance dependence
   05031 Amphetamine addiction
    100918689 (PPP3R1)
  Infectious diseases
   05152 Tuberculosis
    100918689 (PPP3R1)
   05166 HTLV-I infection
    100918689 (PPP3R1)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100918689 (PPP3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 170 aa AA seqDB search
MAKAHSSQTHKGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ
QNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNG
ELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVILLE
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggctcacagttcacaaacccataagggaaatgaagcaagctaccccctggaa
atgtgctcacattttgatgctgatgaaattaaaaggctaggaaagagatttaagaagctt
gatctggacaactctggttctttgagtgtggaagagtttatgtctttgcctgagttgcaa
cagaacccattagttcagcgagtaatagatatatttgacacagatggaaatggagaagta
gacttcaaagaattcattgaaggagtttctcagttcagtgtcaaaggagataaagaacag
aaattaaggtttgctttccgaatctatgacatggataaagatggctatatttccaatggg
gagctcttccaggtgctgaagatgatggtggggaacaatctgaaagacacgcaattacaa
caaattgtagacaaaaccataattaatgcagataaggatggagatggaagaatatccttt
gaagaattctgtgctgttattcttctagaataa

DBGET integrated database retrieval system