KEGG   Sarcophilus harrisii (Tasmanian devil): 100918831Help
Entry
100918831         CDS       T02286                                 

Gene name
KAT6B
Definition
(RefSeq) K(lysine) acetyltransferase 6B
  KO
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100918831 (KAT6B)
Chromosome [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100918831 (KAT6B)
   HAT complexes
    MOZ/MORF complex
     100918831 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 2045 aa AA seqDB search
MVKLANPLYTEWILEAIQKVKKQKQRPSEERICHAVSASHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSLKPGTFPKSAKGSRGSCNDLRNVDWNKLLRRAIEGLQE
PNGSSLKNIEKYLRSQSDLTSTTNNAAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLE
GSGAPKYSNTFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRMLSVTSDE
GSTNAFTGRGSPGRGQKTKVCTTPSSGHAASVKDSSSRLAVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLA
TGTTQKLKPPPSSLPPLIPISGQSPSSQKSSTSTSNSPQSSSSQSSGPSFSSLTNHSQLK
GLFDGLSHIYTAQGQSRKKGHPSYAPPKRLRRKPEFSSTTKSSAHFYGKKDNRSRFISHS
SMSSGWGLSRGCIFKAIAHFKRTTFLKKQRMIGKLKYKVTPQMGTPSPGKGSLADGRIKP
DQDDDTEIKISIKQEGTDVNVIGSKDSVTEEDLDVFKQAQELSLEKIGCKNGVESSGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANE
IYRRKDLSVFEVDGNVSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLV
GYFSKEKLCQQKYNVSCIMIMPQYQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLYYHHEKHISIKGISRATGMCPHDIATTLQHLRMIDKREEKFVIIRR
EKLILGHMEKLKTNARVNELDPESLRWTPLLVSNAAVSEEEREAEKEAERLMEQASCWEK
EDQEILSARANSRQSPAKVQSKNKYLRSPESVPMAGDRGQSTEPTKDSSEEEEEEEEEEE
EEEEEEEEEEENHRSSPPRLTKPQSLAMKRKRPFILKKKRGRKRRRINSSVTTETISETT
EVLNEPFDNSDDERPMPQLEPTCEIEGEEDDLKPAIKKVFQFQSGKQRQTEEEEKDNHCF
NNDDPCRNNTDNSNNLKEDSVDNPESLKCKQGWPKGMKRGPSKWKQSKDRKTGFKLNLYT
PPETPMEPDYQVTGEEQKESTQEELSHMSGVAEAAAKEADLPKQPQSEDGGVTAAPPSPR
PLPLEKSEDQGLKPEEEEGEEEEEEEEEEGVLEGDSNRANSRGGPRVEAFVGPKEPEHLE
DHEEEEEEEEPSRNEDHDADDEDDSHLEAAEAQKEELPTEAFKGVLENQDTFLDLSVPAG
PPNPETLMDCSMDLAAPCSGEPKECPADAKGVPEPDGGHPGGPAEGEGQKKREDRNPEFK
EETPETMEIDSETVQAVQSLTQENPGQDDTFQECAETQEACQSLQSYSQADQSPPMAPLD
DCPQSNHSSPVSSVHSHPGQSVRSVSSPSVPALESSYPQISPDQGAISVPSLQNMETSPM
MDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSSMGSSICGNTSSQNSCSYSSL
TSSNLTQSSCAVTQQMSGMNGSCSMMQPASISSPPTCNVKSPQGCVGERPPSGSQQLPQC
SLAATFTPPMQLAEIPEAGGANLGLYERMGQSEFGAGHYPQPSATFSLAKLQQLTNTLID
HSLPYSHSAAVTSYANSASLSTPLSNTGLVQLSQSAHSVPGGPQAQATMTPPPNLTPPPM
NLPPPLLQRNMAASNLGISHTQRLQTQIASKGHAAMRTKSASLPPAAAAHQPQLYGRASQ
TVAMQGPARTLTMQRGMNMSVNLMPAPAYNVNSVNMNMNTLNAMNGYGMSQAMMNSGYHG
NHGYMNQTAQYPMQMQMGMMGTQPYAQQPMQTPPHGNMMYTAPGHHGYMNTGMAKQPLNG
SYMRR
NT seq 6138 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttacacagagtggattcttgaagcgatacagaaagtc
aaaaaacaaaagcagaggccatctgaggaaaggatctgccatgcagtatcagcttcccat
ggactggataagaagactgtttctgagcagctagaactgagtgttcaggatggctctgtt
ctcaaagttaccaacaaaggccttgcttcctacaaggacccagacaatcctggacgtttt
tcatcccttaaaccaggcacttttcctaagtctgccaaggggtctaggggatcctgcaat
gatctccgcaatgtggactggaataaactcttaaggagagcaatcgaagggcttcaagaa
ccaaatggctcctccctgaagaacatagaaaaatatcttagaagtcaaagtgacttaaca
agcaccaccaacaatgctgcctttcagcagcgattacgactgggggccaaacgtgctgta
aataatgggaggttactgaaagatggacctcagtatagggtaaattatggtagtttagaa
gggagtggagctccaaaatattccaatacttttccatcttcccttcctcctgtcagcctt
ctaccccatgagaaagaccagcctcgtgctgatcccattccaatatgtagcttctgtttg
gggacaaaagaatcaaatcgagagaaaaaacctgaagaactcctgtcttgtgcagattgt
ggcagtagtggacacccatcatgtttgaaattctgtccagaattaacaacaaatgtaaag
gccttaagatggcagtgtattgaatgcaagacatgtagtgcatgtagaatccaaggcaaa
aatgcagataatatgcttttttgtgattcttgcgatagagggttccacatggaatgctgt
gatccaccgctttccagaatgccaaaagggatgtggatttgccaagtctgcagaccaaag
aaaaagggaagaaaactccttcatgagaaagctgcacaaattaaacgacgatatgcaaaa
cctattggacgaccgaaaaataaactaaaacaacgaatgttgtctgtaaccagcgatgaa
ggatccacgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgtgaaggactcaagcagcagattggct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacata
tctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggccttactaag
ttttttacaccatcacccgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggaaaaaggtctcccagaaacagtcatgcacttctcatgtgttggct
acaggtaccacacaaaagctaaaacctccaccttcttcacttccacccttaatccccatc
tctggtcagagccctagttcacaaaaatccagcacctccacttctaattctccccagagt
tcttctagtcaatcaagtgggccctcctttagcagccttactaatcacagtcagctgaag
ggactttttgatggactttctcatatttatactgctcagggacagtctcgaaaaaaggga
cacccaagttatgcaccacccaaacgcttgcgtcgtaaacctgaattctcttccacaaca
aaatctagtgcccatttctatgggaaaaaagataatagaagtaggtttatttctcactcc
tccatgtcctctggctggggactgtctagaggatgtatttttaaagcaattgcccacttc
aagcgaacaactttccttaaaaagcagaggatgataggcaaattaaagtataaagtgacc
cctcagatggggaccccctcaccagggaaggggagcttggcagacggaaggattaaacct
gatcaggatgatgatactgaaatcaaaatcagcatcaaacaagaagggacagatgtaaat
gtgatcggaagcaaggattctgttacagaagaagatttggatgtctttaaacaggcacaa
gaactttccttggagaaaatagggtgtaaaaatggtgtggaatccagtggacggtatcct
tcagtaatagaatttggaaagtatgaaatccaaacctggtattcttcgccttatccacag
gaatatgcaagattaccaaagctttacctgtgtgaattctgtcttaaatacatgaaaagt
aaaaacattttgttaaggcactcaaagaaatgtggatggtttcatcctccagcaaatgaa
atctacaggagaaaagatctgtcagtgtttgaggttgatgggaatgtgagcaaaatttat
tgccaaaatctttgcttgttagccaagctcttcctggaccacaaaaccttgtattatgat
gttgagccgttccttttttatgttttgacaaaaaatgatgaaaagggctgtcatctcgtt
ggatatttctctaaggaaaagctttgccagcagaagtacaatgtctcctgcataatgatc
atgccccagtaccaaaggcaaggatttggaaggtttctcattgatttcagctatttgctt
tccagaagagaaggacaagcagggtctcctgaaaagccgctctccgatttgggccgtctc
tcctatctggcctactggaaaagcgtgattttggagtatctctattaccatcacgaaaaa
catatcagcatcaaagggatcagccgcgccactggcatgtgtcctcacgatattgccacc
actctgcagcacctccgcatgattgacaagcgagaagaaaaatttgtgatcattagaaga
gaaaaactgatattaggtcatatggaaaaactgaaaaccaatgcacgtgtgaatgaactt
gacccagaaagtctgaggtggaccccattgttagtttctaatgctgcagtttctgaagag
gaacgagaagctgaaaaagaggctgaacgtctgatggaacaggctagctgctgggaaaaa
gaagaccaagaaattttatcagctagagctaatagtaggcaatcacctgcaaaagtgcaa
tcaaaaaataaatatttgcggtccccggagagtgtacccatggcaggagaccgagggcaa
tctacagagccaactaaagatagcagtgaagaggaagaagaggaagaagaagaggaagag
gaagaagaagaggaagaggaggaagaggaagaaaatcatcgaagctctcctccccggtta
acaaaaccacaatcacttgctatgaagagaaagagacctttcatactgaagaagaaaaga
ggccgtaagcgtagaaggatcaatagcagtgtgacaacagagacaatttctgaaaccaca
gaagtgttgaacgagccgtttgataactctgatgatgagcggccaatgccacagctggag
cctacctgtgaaatcgagggagaagaagatgacttgaagcctgccattaaaaaagtattc
cagtttcaatctgggaaacagagacaaactgaggaagaagagaaagacaatcattgcttt
aataatgatgacccttgtaggaacaacacagataattcaaataatttaaaagaagacagt
gtagacaatccagaatctctaaagtgcaaacaaggatggccaaaagggatgaagcgtggc
ccgtctaaatggaagcaaagcaaagacaggaagactgggtttaaactgaacttgtacacc
ccgcctgagactccaatggagcccgactaccaggtcaccggagaagagcaaaaggaatcc
acccaagaggaactgagccacatgtctggtgtggcagaggcggcagcaaaggaagcggac
ctgcccaagcagccgcagagtgaagatgggggcgtgacggcggcccctccgagcccccgc
ccattaccgttggaaaaatccgaggaccagggcctgaagccagaggaggaagagggtgag
gaggaggaggaagaagaggaggaggagggagttctggaaggagactccaaccgggccaac
agtcggggcgggccccgagtggaggcctttgtgggccccaaggagcccgagcacttggag
gaccatgaggaggaggaggaggaggaggaaccctcccgtaacgaagatcacgatgctgac
gatgaggatgacagtcacttggaggctgcagaagcacagaaggaggagcttcccacagaa
gccttcaagggggtgttggagaaccaggacacttttttagacctgagcgttccagctggt
cccccaaacccagaaaccctgatggactgcagcatggacctggcagctccgtgtagcggc
gagcccaaggagtgtccggcagatgccaagggcgtgcccgagcctgatggggggcatcca
ggaggaccagctgagggtgagggccagaagaaaagggaagatcggaaccccgagttcaaa
gaggagaccccagaaaccatggagatcgactctgagactgtgcaggccgttcagtctttg
acccaggagaaccccgggcaggacgacacctttcaggaatgtgctgaaactcaggaggcc
tgtcaaagccttcagagctactcgcaagcggaccaaagtcccccaatggcccccctggac
gactgcccgcagtccaaccacagcagccctgtctcatccgtccattcacatcccggtcag
tcggttcgttccgtcagcagcccaagcgtccccgcactggagagcagctaccctcagatc
agccccgatcagggggccatctcagtgccatccctgcagaacatggagaccagccccatg
atggacgtcccctccgtctcggaccactcgcagcaggtggtggacagcggcttcagcgat
ctgggcagcatcgagagcaccacggagaactacgagaaccccagcagctatgactcctcc
atgggcagcagcatctgcgggaacacctcttcccagaacagctgctcctacagcagcctg
acttccagcaacctgacgcagagcagctgtgccgtcacgcagcaaatgtccggcatgaac
ggcagctgcagcatgatgcagcccgccagcatcagctcccccccaacctgcaacgtcaag
tccccccagggctgtgtgggggagcggcctccaagcggcagccagcagctgccccagtgc
agcctggcggccaccttcaccccccccatgcagctggccgagatccccgaggcgggcggt
gccaacctgggcctgtatgagcggatgggccagagcgagtttggggccgggcactacccg
cagccatcagctaccttcagccttgccaaactgcagcagttaacgaatactcttattgat
cattcattgccttacagccattccgctgctgtaacttcctatgcaaacagtgcctctttg
tccacaccgttgagtaacacagggctagtgcagctttctcagtctgcgcactctgttcct
ggggggccccaagcacaagcgaccatgacccctccccccaacctcactcctccccccatg
aacctgccgcctcctctcctgcagcggaacatggccgcctccaacctcggcatctctcac
acccaaagactgcaaacgcaaatcgccagcaagggccacgcggccatgagaaccaaatcg
gcgtccctcccgccggccgccgcggcccaccagcctcagctctacgggcgggcttcccag
accgtggccatgcagggcccagccaggactttgacgatgcagcgcgggatgaacatgagc
gtgaacctaatgcccgcccctgcctacaacgtcaactcggtgaacatgaacatgaacacc
ctgaacgccatgaacgggtacggcatgtcccaggccatgatgaacagcggctaccatggc
aaccatggctacatgaatcagacggcccagtacccgatgcagatgcagatgggcatgatg
ggaacccagccatatgcacagcagccgatgcagaccccaccccacggcaacatgatgtac
acggcgcctgggcaccacggctacatgaacaccggcatggccaagcagcccctgaacggc
tcctacatgaggaggtag

DBGET integrated database retrieval system