KEGG   Sarcophilus harrisii (Tasmanian devil): 100918963Help
Entry
100918963         CDS       T02286                                 

Gene name
UNC13B
Definition
(RefSeq) unc-13 homolog B
  KO
K15293  
protein unc-13 A/B/C
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:shr00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    100918963 (UNC13B)
Membrane trafficking [BR:shr04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    100918963 (UNC13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 1595 aa AA seqDB search
MSLLCVRVKRAKFQGSPEKFNTYVTLKVQNVKSTTVAVRGDQPCWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKDDEICGTKNPTPHK
ILLDTRFELPFDIPEEEARYWTHKLEQINALGTDSEYFQEESQKKLLPIAATQCSFEDAD
SAVDDRDSDYRSETSNSIPPPYHTTSQPNASVHQFSVPAQLQQQQLFLQGSSRDSCNDSG
QSYDFDYPERRALSPTGSSRYGSSCNVSQGSSQLSELDQYHEHVHNSEQDDDHRERDSIH
SCHSAGSYTKDGQAGFGEQEKLLEVTSEAEKGKACEPKEMVKEDKTSHLPLELEPHKSSQ
ESYSEETHSSPFTQARAHWIRAVTKVRLQLQEAPDDDDPSRQLWLPSGSAGGLYGIDSMP
DLRKKKPLPLVSDLSLVQSRKAGITSALATRTSLKDEELKSHVYKKTLQALIYPISCTTP
HNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSCK
HGAEDRTQNIIMAMKDRMKIRERNKPEIFDVIRDVFTVSKVVHAQQMKTVKQSVLDGTSK
WSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVWEEKFHFECHN
SSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSA
VSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHHLTDIQGSGGVRIPEAKGDDAWKVY
FDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTA
STNVSACDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLL
TSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYNHQYQTEKQELPPE
DQGPSIRNLDFWPKLITLIVSIIEEDKNAYTSVLNQFPQELNVGKVSAEVMWHLFAQDMK
YALEEHEKNRLCKSADYMNLHFKVKWLHNEYVRDLPVLQGKVPEYPAWFEQFVLQWLDEN
EDVSLEFLHGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPGILAH
YMRRFAKTIGKVLMQYADILAKNFPSYCDKEKLPCILMNNVQQLRVQLEKMFEAMGAKEL
DPEAGDNLKELQVKLNTVLDELSTVFGNSFQTRIDECVRQMADILSQVRGPGNVTPNTRG
SVAQEADGVLRPLMDFLDSNLTLFATVCEKTVLKRVLKELWRVVMNTMEKTIVLPPLTDQ
TGPQLIFTAAKELSHLSKLKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKT
FLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTAQGSGVDDPVGEVSIQVDLFTHPGTG
EHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDRKRKFTTKSKSNNWAPKYNETFH
FLLGNEEGPDAYELQVCVKDYCFAREDRVLGLAVMPLREMAAKGSCACWCPLGRKVHMDE
TGLTILRILSQRSNDEVAREFVKLKSESRSSEEGS
NT seq 4788 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctctgtgtgcgggttaaaagagccaaattccagggttcaccagagaaattt
aatacatatgtgaccctgaaagtacaaaatgtgaagagtacaacagttgcagttagaggg
gaccaaccttgctgggagcaagatttcatgtttgagatcagtcgcttggacctgggttta
agtgtagaagtatggaacaaaggcctgatttgggacacaatggtgggcactgtgtggatt
gcactgaagaccatccggcagtcagatgaggaaggccctggggaatggtccaccttggaa
gcagaaacgttaatgaaagatgacgaaatctgtggaaccaagaacccaactccccataaa
attttgctagatacaagatttgaattgccttttgatattccggaagaagaggcccgatac
tggacccacaaactggaacaaatcaatgctctggggactgacagtgagtatttccaagaa
gaaagccagaagaagctattgcccattgctgccacccagtgttcttttgaggacgctgac
agtgccgtggatgatcgagacagtgattaccgcagtgagaccagcaatagcatccctcct
ccgtatcatactacttcccaacccaatgcttctgttcaccagttctcggtgccagcccag
ctgcagcagcagcagctctttcttcagggcagctctcgggactcctgcaatgactccggg
cagagctatgactttgattacccagagcggagggccctcagccccactggcagcagtagg
tatggttcctcttgtaatgttagtcaaggaagctcgcagctgagtgaactggaccagtat
catgaacatgttcataactcagagcaagatgatgaccatcgagaaagggactcaattcat
tcttgccacagtgctggaagctacacaaaggatggccaagcaggctttggggaacaggag
aaattgctggaggtgaccagtgaagctgagaagggaaaagcttgtgagccaaaggaaatg
gttaaagaagataaaacatctcatcttcctctagaattggagccacataaaagctcccag
gagagttattctgaagagactcattcttcaccatttacacaagctagagcacattggatt
cgagcagttaccaaagtccgactccagctacaagaggctcctgatgatgatgatccctct
aggcagctgtggctccccagcgggtcagctggtggactctatggcattgacagcatgcca
gacctacgcaaaaagaaaccacttcccctcgtcagcgacttgtcactggtccagtccaga
aaggcaggaatcacatctgcattagctacgcggacctccctcaaagatgaagaactgaaa
tctcacgtgtacaagaaaaccttgcaagccttgatctaccctatctcctgcaccactcct
cacaattttgaagtgtggacagccactacacccacctactgctatgaatgtgaaggcctt
ctgtggggcattgctcggcagggcatgcgctgcactgagtgtggtgtgaagtgccatgaa
aagtgccaggatctgctcaatgctgactgcctgcaaagggcagcagaaaaaagctgcaag
catggtgccgaggaccgaactcaaaatatcatcatggctatgaaggatcgcatgaaaata
cgtgagcggaataagccagagatttttgatgttattcgagatgtctttactgtgagcaaa
gttgtccatgcccagcagatgaagacagtgaaacagagtgtgctagatggtacctccaag
tggtcagccaagatcaccatcacagtggtgtgtgctcagggtctgcaggccaaggataag
actggctccagtgacccctatgttactgtgcaagttggaaaaacgaagaaacgaacaaag
accatctttggcaacctgaatcctgtttgggaggaaaagttccattttgagtgccataac
tcttcagatcgaatcaaagtacgagtgtgggatgaagatgatgacatcaagtcaagagtg
aagcagaggctgaagcgggagtcagatgactttcttggccagaccatcattgaagtacga
accctgagtggcgagatggatgtctggtacaacttggaaaagaggacagataagtctgct
gtctcaggggcaatccggctgcatatcagtgtggaaataaagggggaagagaaggtagca
ccatatcatgtgcaatatacatgtctccatgagaatctgttccatcatctcacagacatc
cagggcagtggaggagtccgaatccctgaggccaaaggggatgatgcatggaaggtttat
tttgatgagacagcccaagaaattgtggatgaatttgccatgcgctatggcattgagtca
atataccaggccatgacgcactttgcatgtctgtcctccaagtacatgtgtcctggtgta
ccagcagtgatgagcactctgcttgccaacattaatgcctactatgcccataccacagct
tccaccaatgtctctgcctgtgaccgttttgcagcctctaactttgggaaagagagattt
gtgaaactgctggaccaattgcataactcattgcgaatcgacctctccacataccggaac
aatttccctgctgggagtcctgaaaggctgcaggatctgaaatccactgtggatcttctc
accagcattaccttctttagaatgaaggtacaagaactgcagagtccaccgcgtgccagc
caggtagtgaaggactgtgtgaaggcctgtttgaattccacttatgaatacatcttcaac
aactgtcacgagctgtacaaccaccagtaccagactgaaaaacaggaactgcctccagag
gatcaaggccccagtatccggaatctggatttctggcccaagctcattactctcattgtg
tccatcatcgaagaagataaaaatgcctatacatctgtcctgaaccagttcccccaggag
ctgaatgtgggcaaggtcagtgcagaggtgatgtggcacctatttgcccaggacatgaag
tatgccttggaagagcatgagaagaaccgactctgtaaaagcgctgactacatgaacctg
cacttcaaggtgaagtggcttcacaatgagtatgttcgtgacctgcctgtcctccaggga
aaggtgcctgaatacccagcgtggtttgagcaatttgtgctgcagtggctggatgagaat
gaggatgtgtccctggagttcctgcatggtgcccttgagagagacaagaaagatgggttc
cagcaaacatcggagcacgcgctcttctcctgctccgtggtggatgtcttcacacaactc
aaccagagttttgaaatcattcggaaactggaatgcccagaccctggcatccttgcccac
tatatgcggagatttgccaagaccattggaaaggtgttgatgcaatatgcagatatttta
gccaagaatttcccttcctattgtgacaaggagaaactgccttgcatcctaatgaacaac
gtgcagcagttgagagtgcaactggagaagatgttcgaggccatgggggccaaggagcta
gatcctgaggcaggagacaacctgaaggagcttcaggtgaaactgaacaccgttctcgat
gagctgagcacggtatttgggaacagttttcagactcggattgacgagtgcgttcgacag
atggctgacatcctgagtcaggtgcgcggcccggggaatgtgacccccaacaccagaggc
tcagtggctcaggaggcagacggtgtgctccgacccctcatggacttcctggacagcaac
ctcacgctctttgccacggtgtgtgagaagacggtgctgaaacgggtgctaaaggaactg
tggcgggtggtgatgaacaccatggagaaaacaattgtgctgcccccacttacggaccag
acggggccccagttgatctttacagctgccaaagagctaagccatctctccaaactcaag
gaccacatggtacgggaggagacacggaacctcaccccaaagcagtgtgctgtccttgac
cttgcactggacaccatcaagcaatactttcatgccggtggcaatggactgaagaaaacg
tttcttgagaagagcccagatctgcagtcccttcgctacgccctgtccctctacacacag
accacagacacacttatcaagacctttgtgcggtcacagactgcccaggggtcaggtgtg
gatgatcctgtgggagaagtctccatccaagtggatctgtttacacatcctgggactggg
gaacacaaggtcacagtgaaagtggtggctgccaacgatctcaaatggcagacagcaggc
atgttcaggccttttgtggaggtgaccatggttggcccacaccagagtgaccgaaaaagg
aaatttacaaccaagtccaagagcaacaactgggcccccaagtacaatgagacgtttcac
ttccttttggggaatgaggaagggcctgatgcctatgaacttcaggtgtgtgtgaaggac
tactgctttgcacgtgaggaccgggtgctggggctagcagtgatgccattgagggagatg
gcagccaaaggtagctgtgcctgctggtgccccctgggccgtaaggtccacatggatgaa
acaggcctgactattcttcggattctgtcccagagaagcaatgatgaagtggctcgagag
tttgtgaagctcaaatcagagtctcgctcctcagaggaagggagttga

DBGET integrated database retrieval system