KEGG   Sarcophilus harrisii (Tasmanian devil): 100919035Help
Entry
100919035         CDS       T02286                                 

Gene name
ST3GAL5
Definition
(RefSeq) lactosylceramide alpha-2,3-sialyltransferase isoform X1
  KO
K03370  lactosylceramide alpha-2,3-sialyltransferase (sialyltransferase 9) [EC:2.4.99.9]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00604  Glycosphingolipid biosynthesis - ganglio series
shr01100  Metabolic pathways
Module
shr_M00069  Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    100919035 (ST3GAL5)
Enzymes [BR:shr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.9  lactosylceramide alpha-2,3-sialyltransferase
     100919035 (ST3GAL5)
Glycosyltransferases [BR:shr01003]
 Terminal extension
  Sialyltransferase
   100919035 (ST3GAL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29 Cornichon
Motif
Other DBs
NCBI-GeneID: 100919035
NCBI-ProteinID: XP_023351034
Ensembl: ENSSHAG00000015309
Position
1
AA seq 408 aa AA seqDB search
MGCLCSGCHLGWESQELFSMPNEYSYMKLKSDCPPSLPWYAQPPKKMRRPSLLLKGILKC
LLLVFGVWILYILKLSYSAEECDMKRVHYVDPERVKRAQKYAQQVLQGECRPGFVKKEME
RLFDQKYDMDSSPFVKENMEMNEDVYKYDPPFGFRKFSSKLQNLLKLLPEHDLPENLKAK
RCKHCVVMGNGGILNGLGLGHILNQFDIVIRLNSAPVQGYTDHVGNKTTIRMTYPEGAPL
SDLEYYSNDLFVAVLFKSVDFNWLEAMIKNETVPLWVRLFFWKHVAEKIPLQSKQFRILN
PVIIKNTAMDMLHYPEPHPRIWGWSQNVPTMGIVAVVLATHLCDEVSLAGFGYDLNQPKT
PLHYFDNLCMAAMNEQTMHNLTTETKFLQKIVKEGTVKDLSGGIHCEF
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcctctgttcaggctgtcatcttggctgggagtcccaggagcttttttcaatg
ccaaatgaatatagctacatgaaactgaagagtgattgccctccttctctgccatggtat
gcccaacctccaaaaaaaatgagaagacccagcctgttattaaaaggcattctcaaatgt
ttgctacttgtgtttggagtgtggatcctctatatcctcaaattaagttacagtgctgaa
gaatgtgacatgaaaagagtgcattatgtggatcctgagcgtgtaaagagagcacagaaa
tacgctcagcaagtattgcaaggggaatgtcgccctggttttgtgaaaaaggagatggaa
cgattatttgatcagaaatatgatatggactcatccccttttgtgaaagaaaatatggaa
atgaatgaagatgtatataaatatgatcctccatttggatttcgcaagttctccagtaaa
ttgcaaaatcttttaaaacttttgcccgaacacgatttgcctgaaaacttgaaagcaaaa
cgttgtaaacattgtgttgttatgggaaatggtggaatactgaatggactcggactgggc
cacatattgaatcagtttgatattgtgataaggttaaacagtgcaccagttcagggatat
acagatcatgttgggaataaaactactataaggatgacttatccagagggagctccattg
tctgacctcgagtattattctaatgacttgtttgttgctgttttatttaagagcgttgac
ttcaactggcttgaagcaatgataaaaaatgaaacagtgccgctttgggtgcgcctgttc
ttttggaagcacgtcgctgagaaaataccgctccaatcaaagcagtttaggatcctgaac
ccagtcatcatcaaaaatactgctatggacatgctgcattacccagaacctcacccaaga
atctggggctggagtcagaacgtacccacaatgggcatcgttgctgttgtcctggccact
catctgtgtgatgaagtcagtttggcaggttttggatatgatctcaaccagcccaagact
cctttacactattttgacaacctctgcatggcagcaatgaatgaacaaactatgcataat
ctgacaacagaaaccaaatttctgcaaaagatcgtgaaagaagggactgtgaaagacctg
agcggaggaatacattgtgaattttaa

DBGET integrated database retrieval system