KEGG   Sarcophilus harrisii (Tasmanian devil): 100919191Help
Entry
100919191         CDS       T02286                                 

Gene name
CHRM1
Definition
cholinergic receptor, muscarinic 1
Orthology
K04129  
muscarinic acetylcholine receptor M1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Cholinergic synapse
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:shr04020]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:shr04151]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:shr04080]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:shr04810]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:shr04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 211 aa AA seqDB search
SPDVPARRCCCCWGPRLLPSYSWKEEEEEEEDEGYLESLTSSEGEEAGFEVVIKMPMVGP
EAPAPAKPPPRASPQTVKRPTKKARERAGKEPKKKGKEQLSKRKTFSLVKEKKAARTLSA
ILLAFILTWTPYNIMVLVSTFCTDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTF
RLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 637 nt NT seq  +upstreamnt  +downstreamnt
ctcccccgacgtcccggcccggcgctgctgctgctgctggggaccgcggctcctcccctc
ctacagctggaaggaagaggaggaggaggaggaggacgaaggctacctggagtccctgac
gtcctccgagggagaggaggcgggcttcgaggtggtcatcaagatgcccatggtgggccc
ggaagccccggctccggccaagccgccccctcgcgcctccccccagacggtgaagcggcc
caccaagaaggcccgcgagcgggcgggcaaggagcccaagaagaaagggaaggagcagct
gagcaagcgcaagaccttctcgctggtcaaggagaagaaagcggccaggaccctgagcgc
catcctcctggccttcatcctgacctggaccccgtacaacatcatggtgctggtgtccac
cttctgcactgactgcgtgcccgagaccctgtgggagctgggctactggctctgctacgt
caacagcaccatcaaccccatgtgctacgcgctctgcaacaaggccttccgcgacacctt
ccgcctgctgctgctctgccgctgggacaagaggcgctggcggaagatccccaagcggcc
cggctccgtgcaccggacgccctcccggcagtgctga

DBGET integrated database retrieval system