KEGG   Sarcophilus harrisii (Tasmanian devil): 100919191Help
Entry
100919191         CDS       T02286                                 

Gene name
CHRM1
Definition
(RefSeq) muscarinic acetylcholine receptor M1
  KO
K04129  
muscarinic acetylcholine receptor M1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Cholinergic synapse
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100919191 (CHRM1)
   04024 cAMP signaling pathway
    100919191 (CHRM1)
   04151 PI3K-Akt signaling pathway
    100919191 (CHRM1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100919191 (CHRM1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100919191 (CHRM1)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    100919191 (CHRM1)
G protein-coupled receptors [BR:shr04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    100919191 (CHRM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
6
AA seq 326 aa AA seqDB search
MDDKKKKRSPKPCLSQPAPSAGALRRVPVPTSRSASFSLGLPHLPSPKQRTKFKRVTKEK
GRPVLAGGGGAPAGTPLQHSFLTEVTGVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLE
HVREMQEKLARLHFSLDVCGEEEEEEDEGYLESLTSSEGEEAGFEVVIKMPMVGPEAPAP
AKPPPRASPQTVKRPTKKARERAGKEPKKKGKEQLSKRKTFSLVKEKKAARTLSAILLAF
ILTWTPYNIMVLVSTFCTDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLL
CRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggatgacaagaagaagaagagaagccctaagccctgtctgtcacagcccgcgccctcc
gccggggctctgcgcagggtcccagtccctaccagccgaagtgcctccttctccttgggc
ctcccccacctaccgtccccaaagcagcggactaaatttaagcgggtgaccaaggagaag
ggccgccctgtgctcgcagggggagggggtgccccagcaggcacccccttgcagcactcc
ttcctgacagaggtgactggagtctatgagatggagggcggcctgctcaacctactcaat
gacttccattctggccggctccaggcctttgggaaggagtgttcctttgagcagctggag
cacgtccgggagatgcaggagaagctagcccggctgcacttcagcctggacgtgtgtgga
gaggaggaggaggaggaggacgaaggctacctggagtccctgacgtcctccgagggagag
gaggcgggcttcgaggtggtcatcaagatgcccatggtgggcccggaagccccggctccg
gccaagccgccccctcgcgcctccccccagacggtgaagcggcccaccaagaaggcccgc
gagcgggcgggcaaggagcccaagaagaaagggaaggagcagctgagcaagcgcaagacc
ttctcgctggtcaaggagaagaaagcggccaggaccctgagcgccatcctcctggccttc
atcctgacctggaccccgtacaacatcatggtgctggtgtccaccttctgcactgactgc
gtgcccgagaccctgtgggagctgggctactggctctgctacgtcaacagcaccatcaac
cccatgtgctacgcgctctgcaacaaggccttccgcgacaccttccgcctgctgctgctc
tgccgctgggacaagaggcgctggcggaagatccccaagcggcccggctccgtgcaccgg
acgccctcccggcagtgctga

DBGET integrated database retrieval system