KEGG   Sarcophilus harrisii (Tasmanian devil): 100919206Help
Entry
100919206         CDS       T02286                                 

Gene name
PLCG2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 isoform X2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00562  Inositol phosphate metabolism
shr01100  Metabolic pathways
shr01521  EGFR tyrosine kinase inhibitor resistance
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04020  Calcium signaling pathway
shr04064  NF-kappa B signaling pathway
shr04066  HIF-1 signaling pathway
shr04070  Phosphatidylinositol signaling system
shr04072  Phospholipase D signaling pathway
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04380  Osteoclast differentiation
shr04611  Platelet activation
shr04625  C-type lectin receptor signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04670  Leukocyte transendothelial migration
shr04722  Neurotrophin signaling pathway
shr04750  Inflammatory mediator regulation of TRP channels
shr04919  Thyroid hormone signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05167  Kaposi's sarcoma-associated herpesvirus infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05214  Glioma
shr05223  Non-small cell lung cancer
shr05225  Hepatocellular carcinoma
Module
shr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100919206 (PLCG2)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100919206 (PLCG2)
   04012 ErbB signaling pathway
    100919206 (PLCG2)
   04370 VEGF signaling pathway
    100919206 (PLCG2)
   04064 NF-kappa B signaling pathway
    100919206 (PLCG2)
   04066 HIF-1 signaling pathway
    100919206 (PLCG2)
   04020 Calcium signaling pathway
    100919206 (PLCG2)
   04070 Phosphatidylinositol signaling system
    100919206 (PLCG2)
   04072 Phospholipase D signaling pathway
    100919206 (PLCG2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100919206 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    100919206 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    100919206 (PLCG2)
   04662 B cell receptor signaling pathway
    100919206 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    100919206 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    100919206 (PLCG2)
   04670 Leukocyte transendothelial migration
    100919206 (PLCG2)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100919206 (PLCG2)
  Nervous system
   04722 Neurotrophin signaling pathway
    100919206 (PLCG2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100919206 (PLCG2)
  Development
   04360 Axon guidance
    100919206 (PLCG2)
   04380 Osteoclast differentiation
    100919206 (PLCG2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100919206 (PLCG2)
   05206 MicroRNAs in cancer
    100919206 (PLCG2)
   05205 Proteoglycans in cancer
    100919206 (PLCG2)
   05225 Hepatocellular carcinoma
    100919206 (PLCG2)
   05214 Glioma
    100919206 (PLCG2)
   05223 Non-small cell lung cancer
    100919206 (PLCG2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100919206 (PLCG2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100919206 (PLCG2)
   05169 Epstein-Barr virus infection
    100919206 (PLCG2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100919206 (PLCG2)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100919206 (PLCG2)
Membrane trafficking [BR:shr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100919206 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100919206 (PLCG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12 GDPD
Motif
Other DBs
NCBI-GeneID: 100919206
NCBI-ProteinID: XP_003757898
Ensembl: ENSSHAG00000011637
UniProt: G3WDW2
Position
1
AA seq 1264 aa AA seqDB search
MTTKINLESLPEYEKSQIKRTLELGTVMTLFSLKKSNPERRTVQVITETRQVAWSKTADK
IEGFLDLMEIKEIRPGKNSKDFERGKASRQKEDCCFTIFYGTQFVLNTLSLAVDSKEDAN
KWLCGLTILHQEAQNASTPAIIESWLRKQIYSVDQTRRNSISFRELKTILPLVNFKVSSA
KFLKDKFLEIGAYKDELSFEQFHLFYKKMMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQEIWAQDLSKVREQMTKFIDDTMRETAEPFLFVDEFLTYLFSKENS
IWDDKYDSVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTESYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIRDHAFVSSQFPVILSIEEHCCVEQQRHMARV
FKDVFGDLLLTKPTEASADQLPSPAQLKEKIIIKHKKLGPRGDVDINIEDRKEEKKQQGE
LYMWDTIDQKWYRHYCAIADEKLSFSDVIEQNMEEDSAKDVAQTDLHFGEKWFHKRMEKR
TSAEKLLQEYCAETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTPEGGAMKYY
LTDNLMFNSIYDLIQHYREAHLRCAEFELRLTDPVPNPNPHESKAWYYDSLSRGEAEDML
MRIPRDGAFLIRKREGGDAYAITFRAKGKVKHCRINKDGHHFVLGTSAYFESLVELVNYY
EKHALYRKMRLRYPVTPELLERYNTERDINSLYDVRMYVDPSEINPSTPQRTVKALYDYK
AKRGDELSFCRGALIHNVSKESGGWWKGDYGGRIQQYFPSNYVEDISTVDFEELEKQIIE
DNPLGSLCRGILDLNTYNVVKVPHGKNQKPFVFILEPKKPNDPPIEFATDKVEELFEWYQ
SIREITWKNATVENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVET
KADSIVRQKPIDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKYM
QLNHALFALNGRTGYVLQPESMRNENYDPTPPESQRKILMTLTVKVLGARHLPKLGRSIA
CPFVEVEICGTEYDNNKFKTTVVNDNGLSPVWASTQEKVTFEIYDPNLAFLRFVVYEEDM
FSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSCR
QLRRRQEELNNELFLYDSHQNLRNANRDALMNEFNVNENQLQLYQEKCNRRLREKRVSNS
KFYS
NT seq 3795 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaagatcaacttagagagtcttcctgaatatgagaagagtcagatcaagagg
accctggaattgggaactgtcatgaccctgtttagccttaagaaatctaaccctgagagg
agaacggtccaggtcatcacagagaccaggcaggtggcatggagtaagacggctgacaag
atcgaagggttcttggacctaatggagataaaggaaatccgcccagggaaaaactcaaag
gactttgaacgtgggaaagccagtcgccagaaagaagattgctgctttaccatattttat
ggcacccagtttgtgctcaacaccctgagtttagcagtggactccaaagaagatgctaat
aaatggctttgtggcttgacaattttgcaccaagaagcccagaatgcctcaacaccagct
attattgagagctggctaagaaagcaaatttattctgtagatcaaactcggagaaatagt
atcagcttcagagaactgaagaccattcttcctttagtaaacttcaaagtgagcagcgcc
aagttcctgaaagacaaattcctggaaataggtgcctacaaggatgaactcagctttgaa
cagttccacttattctacaaaaagatgatgtttgagcaacagaaatcaattcttgatgag
ttcaaaaaagattcatctgtgtttattctgggaaatacagatcggccagatgcatctgct
gttcacctgcatgacttccagaggtttctcctgcatgaacagcaggaaatctgggcacag
gatctaagtaaagtaagagagcagatgacaaaatttatagatgacactatgagagaaaca
gctgaaccattcctgtttgtcgatgagttcctcacttatctgttttcaaaagaaaacagc
atttgggatgataaatatgactctgttgatatgcaagacatgaataatcctttgtctcat
tattggatttcttcatctcataacacgtacctcactggagatcaacttcgaagtgaatct
tctactgaatcatacattcgatgtcttcgaatgggttgccggtgtatagagttggattgc
tgggatggacctgatggaaagccaatcatctatcatggctggacacgaacaacgaaaatc
aagtttgatgatgtggtgcaggccatcagagaccatgcttttgtctcctcacagttccca
gtgattctctccattgaagagcactgttgtgtagaacagcagcgtcatatggccagggta
tttaaagacgtgtttggggatctcctccttacaaaacccactgaagccagtgctgaccag
ctgccatcccctgcccagctgaaagaaaagatcatcattaagcacaagaagctgggtccc
agaggagatgtggacatcaacattgaagacagaaaagaagaaaaaaaacagcaaggggaa
ctatacatgtgggacaccattgatcagaagtggtatcgccactattgtgccatagctgat
gagaagttgtccttcagtgatgttatagagcagaatatggaagaagactcagcaaaggac
gtagcacagactgacctgcattttggtgagaagtggtttcataaaagaatggagaagagg
acaagtgctgagaaattactgcaagaatattgtgctgaaaccggaggaaaggatggaacc
ttcttagtccgtgaaagtgagactttccccaatgactacacattgtccttctggagatca
ggcagagtccagcactgtcgaatacggtcgactcctgagggaggggccatgaagtattat
ttgactgacaacctcatgttcaacagcatctatgacttgattcaacactaccgagaagcc
cacctaagatgtgctgaatttgaacttcgtttgacagacccagtgcccaatcccaatcct
catgaatcaaaagcttggtactatgatagcctgagcagaggagaagctgaagacatgttg
atgagaattccccgagatggagccttcctgattaggaaaagagaagggggagatgcatac
gccattactttcagagccaagggaaaagtgaaacactgccggattaacaaagatggacat
cactttgtgctggggacgtctgcttactttgaaagcttagtggaattggtcaactactat
gaaaagcatgcactctacaggaaaatgagattgcgctatcctgtgactccagagctgctg
gaacgttacaatactgaaagggacataaattcactttatgatgtcaggatgtatgtggat
cccagtgaaattaacccttcaacgcctcagagaactgtgaaggctttatacgactacaaa
gccaagcgtggggatgagctcagcttctgtcggggggccctcatccataatgtctccaag
gagtctggtggctggtggaagggtgattatggaggaaggattcagcaatattttccatct
aattatgtggaagacatatcaacagttgattttgaagagctggaaaaacagattattgaa
gataaccctttaggatctctgtgcagaggaatcttggatcttaacacctataatgttgtg
aaagtaccacatggaaaaaaccagaaaccatttgtcttcatcctggaacccaagaaaccc
aatgatcctcctatagagtttgcgactgacaaagtggaagagctctttgagtggtaccag
agcatcagggaaatcacctggaagaatgcaacagtggagaacaacatgaaatattgggag
aagaaccaatcgattgccatagaactatctgatttggttgtctactgtaagccaacaagt
aaaaccaaggataatttagaaaatcctgatttcagagaaattcgctctttcgtggagacc
aaagccgacagcattgttaggcagaagccaattgatcttttgaagtacaatcaaaaggga
ctgactcgggtctaccccaaaggtcaaagggtagactcatcaaattatgatccttttcga
ctttggctttgtggctcccagatggttgccctgaatttccagactgcagataaatatatg
cagctgaatcatgctttatttgcacttaatggtcggactggctacgtcctacagcctgaa
agcatgaggaatgaaaactatgatccaacacctccagagtcacaaagaaagatcctgatg
accttgacagtgaaggtcctgggggctcgtcatctacccaagcttggccgaagcattgcc
tgtccatttgtagaagtggaaatttgtgggactgagtatgataataacaaattcaagact
actgtagtaaatgataatggcctgagtccagtctgggcttctactcaggaaaaagtgaca
tttgagatttatgacccaaatcttgcatttctacgatttgttgtgtatgaggaggatatg
ttcagcgatcccaactttctggcacatgctacttatcccattaaaggaatcaaatcaggg
tttagatcagttcctcttaaaaatggttacagtgaagatattgaactggcctctcttcta
gttttctgtgagatgcgtcctgtgttggaaagtgaagaagagctttattcttcctgtcgc
cagcttcgaaggaggcaagaagagctgaataatgagcttttcttgtatgactctcatcag
aacttacgtaacgccaacagagatgctctcatgaatgaattcaatgtcaatgagaatcag
ttgcagttgtatcaggaaaagtgcaacaggagattaagggagaagagagtcagtaacagc
aaattctactcctag

DBGET integrated database retrieval system