KEGG   Sarcophilus harrisii (Tasmanian devil): 100919331Help
Entry
100919331         CDS       T02286                                 

Gene name
USP1
Definition
ubiquitin specific peptidase 1
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    100919331 (USP1)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100919331 (USP1)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100919331 (USP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 688 aa AA seqDB search
MRGSGAAMKPEGLGGRRPAGEPAVRGQARSAPSEALPSGNCKEDNLASYELICSLQSLII
SVEQLQANFLLNPEKYTDELATQPRRLLNTLRELNPMYEGYLQHDAQEVLQCILGNIQET
CQLLKKEELKNAPGGRLPPPQPEEREGRETHTMQDDDSEEGKDKFPKGNVKRKSDNDAGN
PKKKSKLSKELVATEENQRQTRSKRKAAGDSRLEGSPEAVPKGTADGDGARPSHKKSRLK
LNWLKPTSKQPSILSKFCSLGKITTHLGPKGPSKETDSDHEEDLKGEPRGALKEDPEEAA
PPGTSMEDKEGQSLRNKGMEQVCFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVP
VQEEEFSKVQESSEISPEPKTELKSLKWAISQFASVERIVGEDKYFCENCHHYTEAERSL
LFDKMPEVITIHLKCFAATGLEFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLF
AVVMHSGITISSGHYTASVKVTDLNSLELDTENFVVDQMYEMAKADPLNEEDAKALAEEY
DDEVAFRVNGGAQPSKVLSKKNVEGVGLLGGQKSRPDYEFCSGHRASGADKVIGALAENR
SAEASGTSGAQELDRTKEPGGPADLGANGLESKVSDVIQSLKEYEGKWLLFDDSEVKVTE
EKDFLNSLSPATSSTSTPYLLFYKKIIE
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgcgggggtccggcgcggcgatgaaacccgagggactcggaggacgccgcccagccggg
gagcccgcagttcggggacaggcgcggagcgctcccagtgaggccctgccctcgggaaac
tgcaaagaggacaacctggccagctacgagctcatctgcagcctgcagtctctgatcatc
tccgtggagcaacttcaggccaattttcttctgaatccagagaaatacacagatgaactg
gccacccagcccaggcggctcctcaacactctcagggaactgaaccctatgtatgaagga
tacctgcagcacgatgctcaggaggtgttgcagtgcatcttgggaaatattcaggaaaca
tgtcagctcttaaagaaggaagaactgaagaatgcgccaggaggccgactgcctcctccc
cagccagaggagagagaaggcagggaaacgcacaccatgcaggatgatgactcagaggaa
gggaaagacaagttccccaagggaaacgtgaaaaggaaaagtgacaatgacgccgggaat
cccaagaagaagtcgaagctgtctaaggagctggtggccaccgaggaaaaccagaggcag
acccggtccaagagaaaagccgctggtgactctcgcttggagggttctcccgaagccgtc
cccaaagggaccgccgatggggacggcgcccggccaagccacaagaaatcgagactcaaa
ctcaactggctgaagcccaccagcaaacagcccagcatcctctccaagttctgcagtctg
gggaaaatcaccacccacttgggacccaaagggccttcgaaagaaaccgacagcgatcac
gaggaggacttgaaaggggagcccaggggtgctctaaaggaggaccctgaggaagctgca
cccccagggacaagcatggaggacaaagaaggacagtctttgagaaacaaagggatggaa
caagtttgttttgagttggtagagaaattattccaaggccaactggttttgagaactcgg
tgcttggagtgtgaaagcttaacagagaggagagaagacttccaggacatcagcgtccca
gtccaggaggaggagttctccaaagtgcaggagagttcggaaatttctcccgagcccaag
acggagctgaagagcctgaagtgggccatctcgcagttcgcctctgtggagaggatcgtg
ggcgaggacaaatacttctgtgagaactgccatcattacacggaggcggaaaggagcctc
ctttttgacaagatgcccgaggtgataaccatccatttgaagtgctttgcggccactggc
ttggagttcgactgctacggcggcgggctctccaagatcaacacgcccctgctgacgccc
ctcaagttgtccctggaggagtggagcaccaagccgaccaacgacagctatgggctgttt
gctgtggtgatgcacagcgggatcaccatcagcagcgggcactacaccgcctcggtcaaa
gtcaccgacctcaacagtctggaactggacacggagaactttgtggtggaccaaatgtac
gagatggccaaggccgacccgctgaacgaggaggacgccaaggccctggccgaagagtac
gacgacgaagtggccttccgggtcaacggcggcgcccagcccagcaaggtcctgagcaaa
aagaacgtcgaaggcgtcgggcttctcggggggcagaagagccggcccgactacgagttc
tgcagcggccaccgagcgtccggcgcggacaaggtcatcggggccttggctgaaaaccga
agtgccgaggcgagcggcaccagcggggcccaggagctggacagaaccaaggagcccggg
ggcccggcggaccttggcgcaaacgggctggaaagcaaagtgtccgacgtgatacagagc
ttgaaagagtacgaggggaagtggctgctctttgatgattccgaagtgaaggtgacagaa
gaaaaagactttctgaattctctttcccctgcgacatcttccacatccactccttattta
ctgttttataagaaaattatagagtga

DBGET integrated database retrieval system