KEGG   Sarcophilus harrisii (Tasmanian devil): 100919388Help
Entry
100919388         CDS       T02286                                 

Gene name
MAPK15
Definition
mitogen-activated protein kinase 15
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 579 aa AA seqDB search
MSSVEVDEHVAQRYLIKRRLGKGAYGIVWKAVDRRTGEIVAIKKIFDAFRNKTDAQRTFR
EITFLQEFDNHPNIIRLLNVIRAENDRDIYLVFESMDTDLHSVIRKGNLLKDIHKCYILY
QLLRATKFIHSGNVIHRDQKPSNVLLDADCCVKLCDFGLARSLSQLHEEPGNPALTEYVA
TRWYRAPEILLSSHRYTQGVDMWSLGCILGEMLLGRPLFPGTSTLNQLELILAAIPAPNK
EDFLAIGSEYSACVLQRMGPRQLVTLDSRLPPTTPPEALDLLQRLLVFDPEKRLTADEAL
RHPYVRRFHCPAKEPALEYEIILPVDDGVQLSVVDYRNRLYKMILDRRVNSQLQRLEIQR
EVVGDLPRSSSVPLPSQKDPLLQNHTSESAQALGEQPQTSTLRERRAQIPGPRPQSEPAP
SRDTLGPRQGPAPSIWLQHRGFSGKRRQSCWGDTRTLTGPLGEKPGLRWNGPNNFLTAHA
AAVTNQALMRKDSSLMGVMTSTSTRLVPRLPPGSTQDARPLLCPARRMFQSSASQGTIGA
ARAALGGYSQAYGTICRSALYGLPLSYSSLHPLPHVPPS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggtggaggtggacgaacacgtggcccagcgctacctcatcaagcggcggctc
gggaagggggcctatggcatcgtttggaaagctgtagatcgaaggacaggggaaatcgtg
gccatcaagaagatctttgatgccttcagaaacaagacagatgcacagagaacattcaga
gaaatcacgtttctccaggagtttgataatcaccccaacatcatccggcttctgaatgtc
atcagggcagaaaatgacagggacatttacctagtatttgaatccatggacacagacctg
cattctgtcatccggaaagggaacctgctgaaggatattcataaatgttacatcctttac
cagcttctgcgtgcaaccaaattcattcactcagggaatgtcatccacagagaccaaaag
ccctccaatgttcttctggatgctgactgttgtgtaaaactctgtgactttggccttgca
cgttccctgagtcaacttcatgaagaaccagggaacccagccctgacagagtatgtggct
acacgctggtaccgagccccagaaatcctgttgtcttcacaccggtacacacagggtgtg
gacatgtggagcttgggctgtatcctgggggagatgctgcttgggagacctttattccca
ggaacttctaccctcaaccagcttgagctaatcctggcagccatcccagccccaaacaaa
gaggacttcctggccattggctcagaatacagtgcttgtgtcctccagcgcatgggcccc
cggcagctagtgaccctggactcccgcctcccaccaaccactcctcctgaggccctggat
ctgttgcaacgactactagtatttgacccagagaagcggctgacagcagatgaggctctg
aggcacccctatgtgaggagattccactgtccagccaaggaaccagccctggagtatgaa
ataattttgcctgtggatgatggtgtgcaactctctgtggtggactatcgcaaccgactt
tacaagatgatcctggatcgaagggtcaacagtcagctccaaaggctggagattcagaga
gaagtggtgggggatcttccccggtcaagctctgtacccttgccctcccagaaggatccc
ctcctgcagaaccatacctctgagtcagcccaggctctgggggaacaaccccaaacctcc
accctgagggaacgtcgagcacaaatccctggacccaggccacagagtgaacctgccccc
agccgtgacacccttggtccccggcaggggccagcaccctccatctggctacaacatcga
ggtttctcagggaagaggcgacagtcatgttggggtgatactcgcaccctgactggccca
cttggggagaagccaggcctcagatggaatgggcctaacaacttcctcactgcccatgca
gccgcagtgaccaaccaggccctcatgcgcaaggacagctccctgatgggcgtcatgact
tccacaagcacccgtctggtccctcgcctgccccctggctctactcaggatgctcgacct
ctcctgtgtcctgcaaggaggatgttccagtcctctgcctcccaggggactataggggca
gccagggccgccctgggaggctattcccaggcctatggtaccatctgcaggtcagccctg
tatggtctgcccctctcttattcctcccttcatcccctccctcatgtacctccgtcctga

DBGET integrated database retrieval system