KEGG   Sarcophilus harrisii (Tasmanian devil): 100919470Help
Entry
100919470         CDS       T02286                                 

Gene name
PLA2G15
Definition
phospholipase A2, group XV
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:shr00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:shr04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 389 aa AA seqDB search
MSGADYVKFNYSDIEDREKVPGDLGNQLEAKLDKPTVVHYLCSKKTDSYFTLWLNLELLL
PVIIDCWIDNIKLIYNRTTRTTHSPDGVDVRIPGFGDTFSVEYLDPSKVAVGAYFSTLVE
SLASWGYKRGHDVRAAPYDWRRAPNENKYYFQALREMIEKMYEEYGSPVVLVVHSMGNMY
TLYFLNHQSQDWKDKYIHSFVSLGAPWGGVAKTLRVLASGDNNRISVISPLKIREQQRSA
VSTSWLLPYNYTWSSEKVFVRTPKANYTLRDYQKFYKDIDFEDGWFMRQDTEPLVYQMTP
PGVRLHCLYGTGVPTPDSFYYESFSEREPKVFSGDGDGTVNLESSLHCQTWVHQQQQEVT
LLELKGNEHIQMLSNETVLAYLKSVLFGL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtctggagctgattatgtgaagttcaactattctgacattgaagatagggagaaagta
cctggtgacttgggaaaccagctggaagccaagctagacaagcctacggtggttcattac
ctttgctccaagaagacggacagttattttaccctctggttgaatttagagctgctcctt
cctgtcatcatcgactgttggatcgataacatcaagttaatatataatagaaccaccagg
actactcattccccagatggtgtggatgtgaggattcctggctttggagacaccttttct
gtggaatacttagatcctagcaaagttgctgttggagcttatttctctactctggtagag
agtcttgcgagctggggttacaagagaggacatgatgtccgagcagctccctatgactgg
cgaagagccccaaatgaaaataaatactatttccaagccctccgcgagatgattgagaag
atgtatgaggagtacggaagccctgttgtccttgttgtccatagcatgggcaacatgtat
acactttacttcctcaaccatcagtcgcaggactggaaagacaagtacattcattctttt
gtgtcattgggtgctccctggggaggagtggccaagaccctgcgcgtcctagcttcagga
gacaacaacagaatttctgtcatcagtcctctaaaaatcagagagcaacagagatcggcc
gtctcaaccagttggctgcttccctacaattatacctggtcctcggagaaggtctttgtg
agaacccccaaagccaactacaccctccgggactaccagaagttctataaggatattgac
tttgaggatggctggttcatgagacaagacacagagcccctggtctaccagatgacgccc
cctggggtacggctacattgcctctatggtactggggtgccgaccccagactctttctat
tatgaaagcttttcagaacgagaacccaaagtcttctctggcgatggtgatggcacagtg
aacctggagagctccctgcactgccagacgtgggtgcaccagcagcagcaggaggtgacc
ctcttagagctcaagggcaacgaacacatccagatgctctccaatgagacggttctcgcc
tacctgaaaagtgttctctttggtttgtga

DBGET integrated database retrieval system