KEGG   Sarcophilus harrisii (Tasmanian devil): 100919671Help
Entry
100919671         CDS       T02286                                 

Definition
cytochrome c 2-like
Orthology
K08738  
cytochrome c
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100919671
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100919671
   04115 p53 signaling pathway
    100919671
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100919671
   05210 Colorectal cancer
    100919671
   05222 Small cell lung cancer
    100919671
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100919671
   05012 Parkinson's disease
    100919671
   05014 Amyotrophic lateral sclerosis (ALS)
    100919671
   05016 Huntington's disease
    100919671
  Cardiovascular diseases
   05416 Viral myocarditis
    100919671
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100919671
  Infectious diseases
   05134 Legionellosis
    100919671
   05152 Tuberculosis
    100919671
   05164 Influenza A
    100919671
   05161 Hepatitis B
    100919671
   05168 Herpes simplex infection
    100919671
   05145 Toxoplasmosis
    100919671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 104 aa AA seqDB search
MEDVEEGRKIFVQKCAQCHTVEKNGKHKTGPNLWGLFGRRTGQASGYSYSEANKNKGIIW
NETNLVEYLENPKKFIPGTKMIFPGIRKRREREALVAYLKRVTK
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgttgaggaaggcaggaaaatctttgttcaaaaatgtgctcagtgtcacaca
gtggaaaaaaatggaaaacataagactggcccaaatctctggggtctgtttggccgaaga
acagggcaagcatctggatattcttattcagaagcaaacaaaaacaaaggtattatttgg
aatgaaactaatctagtggaatatttggagaatcctaaaaaatttatccctgggacaaaa
atgatttttcctggtatccgaaagaggagagagagagaagctcttgttgcatatttgaaa
agagtaacaaaatga

DBGET integrated database retrieval system