KEGG   Sarcophilus harrisii (Tasmanian devil): 100919688Help
Entry
100919688         CDS       T02286                                 

Gene name
GBA
Definition
glucosidase, beta, acid
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:shr00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:shr00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:shr04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 652 aa AA seqDB search
MGPSKRRREVRSPASRRQGWRPQPPKLGTRERRQTEGFPPCVHTWGPLMQEGPRAETGNG
GREEARSQAARHRMGVDSARAGPPLPCDQALIRTLVLVPVPIPGSFLGSRQRMIVQEKWR
CRLGMEHPRDLGKVNNVAATGLGLLLLQMVSCTASSRPCVPQSFGYSSVVCVCNATYCDT
LDPVTLPDSGTFSRYESTRSGRRFELSVGSIQSNWTGKGLLLSLRPDQQFQKIKGFGGAM
TDAAALNILALTPPAQDLLLKSYFSPEGIEYNIIRVPMASCDFSIRVYTYADHPDDFQLT
NFTLPEEDTKLKIPLIHRAQALAQRPTSLFASPWTSPTWLKTNGAVNGKGSLKGKPGDKY
HKTWANYFIKFLDAYAEHKLKFWAVTAENEPSAGMISGYPFQCLGFTPELQRDFVALDLG
PALAQSDHHDTKLLILDDQRLLLPHWAQVVLKDPKAAQYVSGIAVHWYLDFLAPAKATLG
ETHRLFPDMMLFASEACVGSKFWEQSVRLGSWSRGTQYSHSIITNLIYHVVGWTDWNLAL
NPEGGPNWVRNFVDSPIIVDIGKDRFYKQPMFYHLGHFSKFIPEGSQRIGLDASQKTHLE
TVALLRPDGAAVLVVLNSSSQDEPLTIADPAVGFIQTLAPAYSIQTYLWQRQ
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgggaccctcgaagcgccggagagaggtgaggagcccagcctcgcgacgccagggctgg
aggccccagccccccaagttagggacccgggaaagacgccaaacggaaggtttcccaccc
tgcgtgcacacctggggacccttgatgcaggagggaccccgcgcagagacagggaatgga
gggagggaagaggcgcggagccaagcggctaggcaccggatgggagtagactctgcccgt
gctggaccccccctcccttgtgatcaagccctcattcgcaccctcgtcctagtccccgtc
cccatcccgggtagtttcctggggagccggcagaggatgattgtacaggaaaagtggcgc
tgtaggttagggatggaacatcccagggatttggggaaagtcaacaacgtcgctgcaact
ggcttgggattgcttttgcttcagatggtttcctgcacagcgagttcccgtccctgtgtc
ccgcaaagctttggctatagctctgtggtctgcgtctgcaatgctacctactgtgacacg
ctggatcctgtaacacttcctgactctggtacctttagccgatatgagagcacccgaagt
ggacggaggttcgaattgagtgttgggtccatccagagcaactggacaggcaaagggttg
cttctatcccttcgaccagatcaacagtttcagaagataaaaggctttggaggagcaatg
actgatgctgctgccctcaacattctagccctgacacctcctgcccaggatttactcctt
aagtcctacttttctccagaaggcattgaatataacatcatccgagtgcccatggccagc
tgtgacttctctattcgtgtctatacttatgctgaccaccctgacgacttccagttgacc
aatttcacccttcccgaggaggacaccaagctcaagattccccttattcaccgggctcaa
gccctggcccaacgccctacctcactctttgccagcccgtggacatcacctacctggctt
aagaccaatggggcagtgaatgggaaaggatcactcaagggaaaaccaggagacaagtac
cataagacctgggccaactactttatcaagttcctggatgcttatgcagaacataagttg
aagttttgggcagtgacagcagagaatgaaccatcagcgggaatgataagtgggtatccc
ttccagtgcctgggcttcactccagaacttcagcgcgattttgttgcccttgacctaggc
cctgcccttgctcaaagtgatcaccatgacaccaaactactaatactggatgatcaacgc
cttctactgccccactgggcacaggtggtgctgaaggaccctaaagccgctcagtatgtc
tctgggatagctgtgcactggtacctggacttcctggccccagccaaagccacactgggg
gaaacgcaccgcttgttccccgatatgatgctctttgcttctgaggcctgtgtaggctcc
aagttttgggaacagagcgttcggctaggttcctggagccgagggacacagtacagccac
agcattatcactaatctgatctaccatgtagtaggatggacagactggaaccttgccctg
aatcctgaaggggggcccaactgggtgcgcaacttcgtggatagtcccatcattgtggat
ataggcaaggacaggttttataagcagcctatgttttaccatcttggacacttcagcaaa
ttcattcctgagggctcccagaggataggactggatgccagccagaaaacccacctggag
acagtggccttactgcgccccgacggtgctgctgtgttagtggtgctcaatagctcttcc
caggacgaacctcttaccattgctgatcctgctgtgggcttcatacagaccttggcacct
gcctactccattcagacatacctctggcagcgccagtaa

DBGET integrated database retrieval system