KEGG   Sarcophilus harrisii (Tasmanian devil): 100919999Help
Entry
100919999         CDS       T02286                                 

Gene name
MAPK4
Definition
mitogen-activated protein kinase 4
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100919999 (MAPK4)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100919999 (MAPK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 579 aa AA seqDB search
MAEKGDCIANMYGYDLGGRFVDFRPLGFGVNGLVLSATDSQTCRKVAVKKIAMSDAQSMK
HALREIKIIRRLDHDNIVKVYEVLGPKGADLQGELFKFNMAYIVQEYMETDLARLLEQGT
LTEEHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGKMLFAGSHELEQMQL
ILETIPVIREEDKDELLRVMPSFINSTWEVKKPLRNLLPEVNSEAIDFLEKILTFNPMDR
LTAEMGLQHPYMSPYSCPEDEPTSQQPFRIEDEIDDILLMAANQSQLSTWDRYQVSLSSD
LEWRQDRYLDTSEVQRDPRAGSESIVEEVQVDPRKYSQSSSERFLEQSHSSMDRVFDSDC
GRSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKKTAMAPATELPLEEEPSNLF
LEIAQWVKSTQSGLECPSPLPEIQERSLPASPQHRKDPKEGNNGADPQFDLDVFISRALK
LCTKPEDLPDNKLSEINGACISEHPSDIVQTEPYPKERW
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagggtgactgcattgccaacatgtatggctatgacctcggtgggcgcttt
gttgacttccgacccctgggatttggcgtcaatggcttagtgctttcggccaccgacagc
caaacctgccgaaaggtggcagtgaaaaagattgccatgagcgatgctcagagcatgaaa
catgctttacgggaaattaagatcatccgccgcctggaccacgacaacatcgtgaaggtg
tacgaggtcctgggacccaagggggctgaccttcagggggagctttttaagttcaatatg
gcctacattgtccaggaatacatggagacagacttagctcgcctgctggagcagggcaca
ctgaccgaggaacatgccaaattgttcatgtaccagctgcttcgtgggctcaagtacatc
cactctgccaatgtgttacacagggacctgaaaccagccaacatcttcatcagcaccgaa
gacctcgtgctgaagatcggggactttggactggcgaggattgtggatcagcattattcg
cacaagggttatctttcagaagggctggtcacaaaatggtatcgatctccacgcttgctt
ctctctcccaacaactataccaaggccatagatatgtgggcagctggctgcatcttggct
gaaatgctcacagggaagatgctgtttgctgggagtcacgagttggaacagatgcagctt
atcctggagacaattcctgtaatccgggaagaagataaagatgagctgctcagagtgatg
ccctccttcatcaatagcacctgggaagtgaaaaaaccactgagaaacctgctcccagaa
gtcaacagtgaagctattgactttctggagaagatcctgaccttcaaccccatggaccga
ttaacagcagagatgggcctacagcacccttacatgagcccctactcatgcccagaggat
gagcctacctcccagcagcccttccgaattgaggatgagattgatgacatcttactgatg
gcagccaatcaaagccagctctccacctgggacaggtatcaagtcagcctgtcctctgat
ctggagtggaggcaggacaggtacctagacaccagtgaggtacagcgggacccccgtgcc
ggctcagaatccatagtggaagaggtccaggtggacccacgaaaatactcccagagtagc
tctgaacgatttctggagcagtctcactcgtccatggaccgggtgtttgactctgactgt
gggcggtcctgtgactacaaggtgggatcaccgtcctatctggataagttactgtggagg
gacaacaagccccatcactactcagaacccaagcttatcttagacttgtcccattggaag
aagacagccatggcgccagctactgagctccctctggaagaggagccatccaacctcttc
ctggagattgcgcaatgggtgaagagtacccagagcggccttgagtgccccagcccactc
cctgagatccaggaacggagcctgcccgcctcaccccagcaccgcaaggaccccaaggag
gggaacaatggggccgacccccagtttgacttggatgtttttatttccagggccttgaaa
ctctgcaccaagccagaggacctgccagacaacaaactcagcgagatcaatggggcgtgt
atctcagagcaccccagtgacatcgtgcagactgaaccctatccaaaggagagatggtga

DBGET integrated database retrieval system