KEGG   Sarcophilus harrisii (Tasmanian devil): 100920096Help
Entry
100920096         CDS       T02286                                 

Gene name
DHFR
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:shr00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:shr00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 174 aa AA seqDB search
MLKKNQIKNSVKLRSIISAEQDCGQQLVNRSPSKQNLLIMGKKTWFSIPEKHRPLKDRIN
LVLSRELKEPPPGAHYLAKSLDDALDLLELPELADKVDMIWVIGGSSVYKEAMEKPGHQR
LFVTRILQEFECDTFFPEIDLKKYKLLPEYPGVLTDIQEEKGIQYKFEVYEKHD
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaagaatcaaattaagaattcggtgaagctgcgatcaatcatttctgcagaa
caagattgtgggcaacagttagttaacagatcaccaagtaaacagaatctgttgataatg
ggaaagaaaacctggttctccattcctgagaagcatcgacctttgaaagataggattaac
ttagttctcagtagagaactgaaagaacctcctcctggagctcattatcttgccaaaagt
ctggatgatgcattagaccttcttgaacttccagaactagcagataaagtggacatgatt
tgggtaattggaggcagctctgtttataaggaagcaatggagaaacctggtcatcagcga
ctgtttgtgacaagaattttgcaagaatttgagtgtgatacattttttccagaaattgat
ctaaagaaatataaacttctcccagaatatccaggtgttcttactgatatccaggaagaa
aaaggcattcagtataaatttgaagtatatgaaaaacatgattaa

DBGET integrated database retrieval system