KEGG   Sarcophilus harrisii (Tasmanian devil): 100920361Help
Entry
100920361         CDS       T02286                                 

Gene name
UNC13A
Definition
unc-13 homolog A (C. elegans)
Orthology
K15293  
protein unc-13
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:shr00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    100920361 (UNC13A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1756 aa AA seqDB search
MRIHTIYPPNPPRFWGSYAPGLGCGKDEGLWDMFVKDIPRSATSYTVSLDKLRQGVTYEF
RVVAVNDFGYGEPSSPSVAVSVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGNLPCWE
QDFMFEINRLDLGLTVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQVIMT
DNEICGTKDPTFHRILLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDDYSFQEEQDKP
LPVPSSQCCNWSYFGWGEQQNEDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQY
SVRPPPLGSRDSRDSYSDSMRSYEDYSEAPPVSPTGSSRYASSGELSQGSSQLSEDFDPD
DQSLQGSEIEEERDRDSYHSCHSSVSYHKDSPHWDQNEEEEEEDLEEEEEEDLEEEDLED
LEDLEDEELRQEGYSENEEEYSKEESYPPTAPTTSEREEKPSPVSTEVPEVAKMPPEPAG
AEEVPGAERAPEPEPPKLEERAREDEEGQDSMSRAKANWLRVFNKVRMQLQEARGEGDMS
NSLWFKGGPGGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAGITSALASSTLNNEEL
KNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCH
EKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEIFAVS
KTTHTQQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRT
KTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEV
RTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHFVTD
VQNSGAVRIPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPG
VPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYR
NNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIF
NNCHELYSREYQTDPAKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQ
FPQELNVGKISAEVMWNLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYNEYVTELP
SFKDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDV
FSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYAEIISKDFTTYCSKEKEKVP
CILMNNTQQLRVQLEKMFEAMGGKELDAEASDILKELQVKLNNVLDELSRLFATSFQPHI
EECVKQMGDILSQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLK
RVLKELWKLVMNTMEKTIVLPPLTDQTMIGTLLRKHGKGLEKGRVKLPSHSDGTQMIFNA
AKELGQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQ
SLRYALSLYTQATDLLIKTFVQTQSAQGSGVDDPVGEVSVHVELFTHPGTGEHKVTVKVV
AANDLKWQTSGIFRPFIEVNIIGPQLSDKKRKFATKSKNNSWAPKYNETFQFTLSADAGP
ECYELQVCVKDYCFAREDRTVGLAVLELKVLLQRGSCACWLPLGRRIHMDDTGLTVLRIL
SHLLGPNLEAICLQPS
NT seq 5271 nt NT seq  +upstreamnt  +downstreamnt
atgcggatccacaccatctatcccccgaacccgcctcgcttctggggttcttatgctcca
gggctggggtgtggaaaggatgaaggcctatgggatatgtttgtgaaggatatcccccga
agcgctacatcctacactgttagtttggacaagctccggcagggggtgacctatgaattc
cgagtggtggcagtgaatgattttggctatggagaacctagcagtccttctgtagctgta
tcagtcaaaaaagccaagtttgatggtgctcaagaaaaattcaatacctacgtgaccctg
aaggtgcagaatgttaagagcaccaccatcgcggtgcgggggaacctgccatgctgggag
caggatttcatgtttgaaattaatcgcctggaccttggcttgacagtggaagtttggaat
aaagggctcatctgggacaccatggtgggcactgtgtggattcccctacggaccattcga
cagtctaatgaggagggccctggtgaatggctcaccctggactctcaagtcatcatgaca
gacaatgagatctgtggtactaaggaccccaccttccatcgaattctcctggatacccgc
tttgaactgcccttggacatccctgaggaagaggctcgatattgggcaaagaagctggag
cagttaaatgctatgagggaccaggatgattattcattccaagaagaacaggacaagcct
cttccagtccccagctcccagtgttgcaactggagttattttggctggggggagcagcag
aatgaagacccagacagcgctgtggatgatcgggacagtgattaccgcagcgagaccagt
aacagcatcccaccgccatactacaccacatcccagccaaatgcctctgtccaccagtat
tcagttcgacctcctccactgggctcccgagactcccgggattcttacagtgactctatg
aggagttatgaagactactcagaagcacctccagtcagcccaactggtagcagccgctat
gcctcctctggggaactgagccagggcagctcccagctgagcgaggactttgatccagat
gaccagagcttgcagggctctgagatagaggaagagagagaccgagactcttaccactcc
tgccacagctcggtgagctatcacaaagactccccgcattgggatcagaatgaagaggag
gaggaagaggacttggaagaggaggaggaagaggacttggaagaggaagacctagaagac
ttggaagatctggaggatgaagagctgaggcaggaaggctatagtgagaatgaagaagaa
tactctaaggaggagagctacccaccaactgcacccaccacctcagaaagagaggaaaaa
ccctctccagtatctactgaagtcccagaagtggccaagatgccgccagagccagcagga
gcagaggaggtgcctggggcagagcgagcacctgagccggaacctccaaagctggaagag
agggctcgggaagatgaagaaggacaagactccatgtccagagccaaggctaactggcta
cgagtattcaacaaagtccgaatgcagcttcaggaggctcgaggagaaggagacatgtct
aactcactttggttcaaaggcgggcctggcggtggtctcatcatcatagacagcatgccg
gacattcgcaaaagaaaaccgattccccttgtgagcgacttggcgatgtccctggtccag
tcccggaaggctggaatcacctctgcactggcctccagcaccttaaacaatgaagagcta
aaaaaccatgtttacaagaagacgcttcaagccttaatctaccccatctcctgcacaacc
ccccacaacttcgaggtgtggacggccaccacacccacctactgctatgagtgtgagggg
cttctgtggggcattgctcggcagggcatgagatgtaccgagtgtggggtcaagtgtcat
gagaagtgccaggacttactcaatgctgactgcctgcagcgagctgcagagaaaagctcc
aagcatggggccgaggaccgcacacagaacatcattatggtgcttaaggaccgcatgaag
atccgggagcggaataagcctgagatctttgagctgatccaggagatctttgcagtctcc
aagacaacacatacacaacagatgaaggctgtgaaacagagcgtcctggatgggacatcc
aagtggtcggctaagatcagtatcactgtggtctgtgcccagggacttcaggcaaaggat
aaaaccggctccagtgacccctatgttactgtccaggtcggcaagacgaagaaacgaact
aaaaccatctatgggaatctcaaccctgtgtgggaagagaacttccattttgagtgccat
aactcttcagaccgcatcaaggtgcgtgtctgggatgaggatgatgacatcaaatctcga
gtgaaacagaggttcaagcgagagtcagatgactttctgggccagaccatcattgaagta
cgaacattgagcggagagatggatgtctggtacaacttagacaagcggacagacaagtca
gccgtgtctggagccatccgattacatatcagtgtagaaatcaagggtgaggagaaggtg
gccccataccatgtccagtacacatgtctgcatgagaacctgttccactttgtaacagat
gtgcagaacagtggtgctgtccggatcccagacgcaaagggtgatgatgcttggaaagtc
tattatgatgagactgcccaggaaattgtggatgaatttgccatgcgctatggcgtcgaa
tccatctatcaagccatgacacactttgcctgcctctcttccaagtacatgtgccctgga
gtacctgcggtcatgagcactctgttagccaacattaatgcctactacgcccacaccaca
gcctctaccaatgtctctgcttctgaccgatttgctgcctccaactttgggaaagagcgc
tttgtgaaactcctggaccagctacacaactccctgagaattgacctgtccatgtaccgg
aataacttcccagcaagcagcccagagaggcttcaggatctcaagtctactgtggacctt
ctcaccagcattaccttcttccggatgaaggtccaggaactacagagcccacctcgtgcc
agccaagtggtaaaggactgtgtgaaggcctgcctcaattccacgtatgaatacatcttt
aacaactgccatgaactctatagtcgagaataccagactgacccggctaagaagggtgag
gtgcctccagaggagcagggacccagcatcaagaacttggacttttggtccaagctcatt
acactcatcgtgtctatcattgaggaagacaagaactcctatacaccctgcctcaatcag
ttcccccaagagctgaatgtgggcaagatcagtgcggaggtgatgtggaacctgtttgct
caggacatgaagtatgccatggaggagcacgacaaacaccgattgtgcaagagtgccgat
tatatgaacttgcacttcaaagtcaaatggctgtacaatgagtatgtgactgagctgccc
tcgttcaaagaccgtgtgcctgagtatccagcgtggtttgagccctttgttatccagtgg
ctggatgagaacgaggaggtgtcccgggatttcctccatggagctttggagcgtgacaag
aaggatgggttccagcagacctctgagcatgctctgttctcctgctctgtggtggatgtc
ttttcccagctcaaccagagctttgagatcatcaagaaacttgagtgtcctgacccccag
attgttggccactacatgcgccgatttgccaagacaattagcaacgtcctgttgcagtat
gctgagatcatctccaaggacttcacaacctactgttctaaggagaaggaaaaagtgccg
tgcatcctcatgaacaatacacagcaacttcgggtgcaactggaaaagatgtttgaggcc
atgggtgggaaggagttggatgccgaagccagtgacatcctgaaggagcttcaggtgaaa
ctcaataatgtactggatgagctcagtcgactatttgccaccagcttccagccacacata
gaagagtgtgtcaagcagatgggggacatcctgagtcaagtgaaaggcacaggaaatgtg
ccagccagtgcctgcagcagtgttgcccaggatgctgacaacgtcctacagcccatcatg
gacctgctggacagcaacctgaccctctttgccaaaatctgtgagaagactgtgctgaag
cgtgtactgaaggagctctggaagctggtgatgaacacaatggagaagaccatagtcctg
cctcccctcacagaccagacgatgattggaacgctcttgagaaaacatggcaagggatta
gagaagggcagggtgaaactccccagccactcagacgggactcaaatgatcttcaatgct
gccaaggagctgggacaactctcaaagctcaaggatcacatggtacgggaagaggccaag
agcttaacccccaaacagtgtgctgtggtggagctggctctggataccatcaagcaatac
ttccatgccggtggagtagggctcaagaagacctttttggaaaagagcccagacttgcaa
tccctccgctatgccctgtctctctacacacaagccacagacctactcatcaaaactttt
gtccagactcagtcagctcagggatcaggagtggatgaccctgtgggtgaggtttctgtc
cacgtggagctcttcactcacccaggtactggagaacacaaggttacagtgaaagttgta
gctgccaatgacctcaagtggcagacgtcagggatctttcgacccttcatcgaggtcaat
atcattgggcctcagcttagtgacaagaaaaggaaatttgccaccaagtccaaaaacaac
agctgggctcccaagtacaacgagaccttccaattcacgctgagcgccgacgcgggcccg
gagtgctacgagctgcaggtctgtgtcaaggactactgcttcgcccgcgaggaccgcacc
gtgggcctggctgtgctcgagctcaaggtgctgctgcagcgcgggagctgcgcctgctgg
ctgcccctgggccgccgcatccacatggacgacacgggcctcaccgtactgcgcatcctc
tcccatctcctgggtcccaatctggaagccatctgccttcagccttcgtaa

DBGET integrated database retrieval system