KEGG   Sarcophilus harrisii (Tasmanian devil): 100920361Help
Entry
100920361         CDS       T02286                                 

Gene name
UNC13A
Definition
(RefSeq) protein unc-13 homolog A
  KO
K15293  protein unc-13 A/B/C
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:shr00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    100920361 (UNC13A)
Membrane trafficking [BR:shr04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    100920361 (UNC13A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 Membr_traf_MHD DUF1041 C1_1 fn3
Motif
Other DBs
NCBI-GeneID: 100920361
NCBI-ProteinID: XP_023352579
Ensembl: ENSSHAG00000010759
Position
2
AA seq 1798 aa AA seqDB search
MRIHTIYPPNPPRFWGSYAPGLGCGKDEGLWDMFVKDIPRSATSYTVSLDKLRQGVTYEF
RVVAVNDFGYGEPSSPSVAVSVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGNLPCWE
QDFMFEINRLDLGLTVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQVIMT
DNEICGTKDPTFHRILLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDDYSFQEEQDKP
LPVPSSQCCNWSYFGWGEQQNEDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQY
SVRPPPLGSRDSRDSYSDSMRSYEDYSEAPPVRRFSSVDPTTRGHSDSEAGRGWPTRHHY
SFENRPSLDLSDSPTGSSRYASSGELSQGSSQLSEDFDPDDQSLQGSEIEEERDRDSYHS
CHSSVSYHKDSPHWDQNEEEEEEDLEEEEEEDLEEEDLEDLEDLEDEELRQEGYSENEEE
YSKEESYPPTAPTTSEREEKPSPVSTEVPEVAKMPPEPAGAEEVPGAERAPEPEPPKLEE
SYRAREDEEGQDSMSRAKANWLRVFNKVRMQLQEARGEGDMSNSLWFKGGPGGGLIIIDS
MPDIRKRKPIPLVSDLAMSLVQSRKAGITSALASSTLNNEELKNHVYKKTLQALIYPISC
TTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEK
SSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEIFAVSKTTHTQQMKAVKQSVLDG
TSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEENFHFE
CHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTD
KSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHFVTDVQNSGAVRIPDAKGDDAW
KVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAH
TTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTV
DLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSREYQTDPAKK
GEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWNL
FAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYNEYVTELPSFKDRVPEYPAWFEPFVI
QWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPD
PQIVGHYMRRFAKTISNVLLQYAEIISKDFTTYCSKEKEKVPCILMNNTQQLRVQLEKMF
EAMGGKELDAEASDILKELQVKLNNVLDELSRLFATSFQPHIEECVKQMGDILSQVKGTG
NVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTI
VLPPLTDQTMIGTLLRKHGKGLEKGRVKLPSHSDGTQMIFNAAKELGQLSKLKDHMVREE
AKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDLLIK
TFVQTQSAQGSGVDDPVGEVSVHVELFTHPGTGEHKVTVKVVAANDLKWQTSGIFRPFIE
VNIIGPQLSDKKRKFATKSKNNSWAPKYNETFQFTLSADAGPECYELQVCVKDYCFARED
RTVGLAVLELKVLLQRGSCACWLPLGRRIHMDDTGLTVLRILSHLLGPNLEAICLQPS
NT seq 5397 nt NT seq  +upstreamnt  +downstreamnt
atgcggatccacaccatctatcccccgaacccgcctcgcttctggggttcttatgctcca
gggctggggtgtggaaaggatgaaggcctatgggatatgtttgtgaaggatatcccccga
agcgctacatcctacactgttagtttggacaagctccggcagggggtgacctatgaattc
cgagtggtggcagtgaatgattttggctatggagaacctagcagtccttctgtagctgta
tcagtcaaaaaagccaagtttgatggtgctcaagaaaaattcaatacctacgtgaccctg
aaggtgcagaatgttaagagcaccaccatcgcggtgcgggggaacctgccatgctgggag
caggatttcatgtttgaaattaatcgcctggaccttggcttgacagtggaagtttggaat
aaagggctcatctgggacaccatggtgggcactgtgtggattcccctacggaccattcga
cagtctaatgaggagggccctggtgaatggctcaccctggactctcaagtcatcatgaca
gacaatgagatctgtggtactaaggaccccaccttccatcgaattctcctggatacccgc
tttgaactgcccttggacatccctgaggaagaggctcgatattgggcaaagaagctggag
cagttaaatgctatgagggaccaggatgattattcattccaagaagaacaggacaagcct
cttccagtccccagctcccagtgttgcaactggagttattttggctggggggagcagcag
aatgaagacccagacagcgctgtggatgatcgggacagtgattaccgcagcgagaccagt
aacagcatcccaccgccatactacaccacatcccagccaaatgcctctgtccaccagtat
tcagttcgacctcctccactgggctcccgagactcccgggattcttacagtgactctatg
aggagttatgaagactactcagaagcacctccagtcagacgcttcagtagcgtcgatcca
accactcggggccacagcgactcggaggctggccggggctggccaacccgccaccactat
tcctttgagaacaggccatccctagacctgtcagatagcccaactggtagcagccgctat
gcctcctctggggaactgagccagggcagctcccagctgagcgaggactttgatccagat
gaccagagcttgcagggctctgagatagaggaagagagagaccgagactcttaccactcc
tgccacagctcggtgagctatcacaaagactccccgcattgggatcagaatgaagaggag
gaggaagaggacttggaagaggaggaggaagaggacttggaagaggaagacctagaagac
ttggaagatctggaggatgaagagctgaggcaggaaggctatagtgagaatgaagaagaa
tactctaaggaggagagctacccaccaactgcacccaccacctcagaaagagaggaaaaa
ccctctccagtatctactgaagtcccagaagtggccaagatgccgccagagccagcagga
gcagaggaggtgcctggggcagagcgagcacctgagccggaacctccaaagctggaagag
agttacagggctcgggaagatgaagaaggacaagactccatgtccagagccaaggctaac
tggctacgagtattcaacaaagtccgaatgcagcttcaggaggctcgaggagaaggagac
atgtctaactcactttggttcaaaggcgggcctggcggtggtctcatcatcatagacagc
atgccggacattcgcaaaagaaaaccgattccccttgtgagcgacttggcgatgtccctg
gtccagtcccggaaggctggaatcacctctgcactggcctccagcaccttaaacaatgaa
gagctaaaaaaccatgtttacaagaagacgcttcaagccttaatctaccccatctcctgc
acaaccccccacaacttcgaggtgtggacggccaccacacccacctactgctatgagtgt
gaggggcttctgtggggcattgctcggcagggcatgagatgtaccgagtgtggggtcaag
tgtcatgagaagtgccaggacttactcaatgctgactgcctgcagcgagctgcagagaaa
agctccaagcatggggccgaggaccgcacacagaacatcattatggtgcttaaggaccgc
atgaagatccgggagcggaataagcctgagatctttgagctgatccaggagatctttgca
gtctccaagacaacacatacacaacagatgaaggctgtgaaacagagcgtcctggatggg
acatccaagtggtcggctaagatcagtatcactgtggtctgtgcccagggacttcaggca
aaggataaaaccggctccagtgacccctatgttactgtccaggtcggcaagacgaagaaa
cgaactaaaaccatctatgggaatctcaaccctgtgtgggaagagaacttccattttgag
tgccataactcttcagaccgcatcaaggtgcgtgtctgggatgaggatgatgacatcaaa
tctcgagtgaaacagaggttcaagcgagagtcagatgactttctgggccagaccatcatt
gaagtacgaacattgagcggagagatggatgtctggtacaacttagacaagcggacagac
aagtcagccgtgtctggagccatccgattacatatcagtgtagaaatcaagggtgaggag
aaggtggccccataccatgtccagtacacatgtctgcatgagaacctgttccactttgta
acagatgtgcagaacagtggtgctgtccggatcccagacgcaaagggtgatgatgcttgg
aaagtctattatgatgagactgcccaggaaattgtggatgaatttgccatgcgctatggc
gtcgaatccatctatcaagccatgacacactttgcctgcctctcttccaagtacatgtgc
cctggagtacctgcggtcatgagcactctgttagccaacattaatgcctactacgcccac
accacagcctctaccaatgtctctgcttctgaccgatttgctgcctccaactttgggaaa
gagcgctttgtgaaactcctggaccagctacacaactccctgagaattgacctgtccatg
taccggaataacttcccagcaagcagcccagagaggcttcaggatctcaagtctactgtg
gaccttctcaccagcattaccttcttccggatgaaggtccaggaactacagagcccacct
cgtgccagccaagtggtaaaggactgtgtgaaggcctgcctcaattccacgtatgaatac
atctttaacaactgccatgaactctatagtcgagaataccagactgacccggctaagaag
ggtgaggtgcctccagaggagcagggacccagcatcaagaacttggacttttggtccaag
ctcattacactcatcgtgtctatcattgaggaagacaagaactcctatacaccctgcctc
aatcagttcccccaagagctgaatgtgggcaagatcagtgcggaggtgatgtggaacctg
tttgctcaggacatgaagtatgccatggaggagcacgacaaacaccgattgtgcaagagt
gccgattatatgaacttgcacttcaaagtcaaatggctgtacaatgagtatgtgactgag
ctgccctcgttcaaagaccgtgtgcctgagtatccagcgtggtttgagccctttgttatc
cagtggctggatgagaacgaggaggtgtcccgggatttcctccatggagctttggagcgt
gacaagaaggatgggttccagcagacctctgagcatgctctgttctcctgctctgtggtg
gatgtcttttcccagctcaaccagagctttgagatcatcaagaaacttgagtgtcctgac
ccccagattgttggccactacatgcgccgatttgccaagacaattagcaacgtcctgttg
cagtatgctgagatcatctccaaggacttcacaacctactgttctaaggagaaggaaaaa
gtgccgtgcatcctcatgaacaatacacagcaacttcgggtgcaactggaaaagatgttt
gaggccatgggtgggaaggagttggatgccgaagccagtgacatcctgaaggagcttcag
gtgaaactcaataatgtactggatgagctcagtcgactatttgccaccagcttccagcca
cacatagaagagtgtgtcaagcagatgggggacatcctgagtcaagtgaaaggcacagga
aatgtgccagccagtgcctgcagcagtgttgcccaggatgctgacaacgtcctacagccc
atcatggacctgctggacagcaacctgaccctctttgccaaaatctgtgagaagactgtg
ctgaagcgtgtactgaaggagctctggaagctggtgatgaacacaatggagaagaccata
gtcctgcctcccctcacagaccagacgatgattggaacgctcttgagaaaacatggcaag
ggattagagaagggcagggtgaaactccccagccactcagacgggactcaaatgatcttc
aatgctgccaaggagctgggacaactctcaaagctcaaggatcacatggtacgggaagag
gccaagagcttaacccccaaacagtgtgctgtggtggagctggctctggataccatcaag
caatacttccatgccggtggagtagggctcaagaagacctttttggaaaagagcccagac
ttgcaatccctccgctatgccctgtctctctacacacaagccacagacctactcatcaaa
acttttgtccagactcagtcagctcagggatcaggagtggatgaccctgtgggtgaggtt
tctgtccacgtggagctcttcactcacccaggtactggagaacacaaggttacagtgaaa
gttgtagctgccaatgacctcaagtggcagacgtcagggatctttcgacccttcatcgag
gtcaatatcattgggcctcagcttagtgacaagaaaaggaaatttgccaccaagtccaaa
aacaacagctgggctcccaagtacaacgagaccttccaattcacgctgagcgccgacgcg
ggcccggagtgctacgagctgcaggtctgtgtcaaggactactgcttcgcccgcgaggac
cgcaccgtgggcctggctgtgctcgagctcaaggtgctgctgcagcgcgggagctgcgcc
tgctggctgcccctgggccgccgcatccacatggacgacacgggcctcaccgtactgcgc
atcctctcccatctcctgggtcccaatctggaagccatctgccttcagccttcgtaa

DBGET integrated database retrieval system