KEGG   Sarcophilus harrisii (Tasmanian devil): 100920472Help
Entry
100920472         CDS       T02286                                 

Gene name
CDC27
Definition
(RefSeq) cell division cycle 27
  KO
K03350  
anaphase-promoting complex subunit 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100920472 (CDC27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100920472 (CDC27)
   04114 Oocyte meiosis
    100920472 (CDC27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100920472 (CDC27)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100920472 (CDC27)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100920472 (CDC27)
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100920472 (CDC27)
Chromosome [BR:shr03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    100920472 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 722 aa AA seqDB search
MPKRKTPSAGECKRLDGSYTGSKGQERRNWGPRSPASPPPSLSWNFPLQCVACGGICKDL
AAPRRRRFREIRGLQGGSIDSTRISGNALPLRRPSCFSGRARAFPASPSFGGFRVALGCT
RQPFGLPHPPRSPVRPSCQSPGAPRGEVRLVYATEGGREGEKASENCGREGRAAIWQALN
HYAFRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAK
CCVDLSNTTPQVLSPTIAAPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTK
SKTNKGGITQPNINDSLEITKLDSSIISEGKISTVTPQIQAFTIQKAAAEGLMSLLRDMG
KGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIEN
YRVEGLEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFF
QRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEK
FSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIIIDPKNPLCKFHRA
SVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKG
ANNQIKEAIDKRYLPDDEEPITQEEQISECYPYESVGTDESQESSMTDADDTQLHAAESD
EF
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagaggaaaacaccgagcgccggggagtgtaaacgattggacggaagttacacc
ggttccaaggggcaggagcgtcgcaactggggtcctcggagcccagcttcgcccccaccg
agcctcagctggaattttccactccagtgtgtagcctgcggaggcatatgcaaagacttg
gctgcgccacggcggcgccggttccgggagatccgagggctccagggaggttcaattgat
tcaactcgcatttccggcaacgctctgccccttcgccggccttcgtgtttttccggccga
gctcgggcatttccggccagccctagcttcggcggtttccgtgttgcactcgggtgtact
cggcagccgttcggcctcccccatcccccgcgctcccccgtccgcccctcctgtcagtcc
ccgggggccccgaggggagaggtacgcctcgtgtacgccactgagggagggagggaggga
gagaaggcgtcggagaactgcgggcgagagggtcgggctgctatatggcaagcactaaac
cactatgctttccgagatgcagttttccttgcagaaagactgtatgctgaagtacactca
gaagaagcattgtttttactggcaacctgttattatcgctcaggaaaggcatataaagca
tatagactcttgaagggacacagttgtactacaccacagtgtaaatatctacttgcaaaa
tgttgcgtcgacctcagcaatacaacacctcaggtattgagccccactattgctgctcca
cccaatgcactgcctcgaagaagctcacgactttttactagtgacagttctacaaccaag
gagaatagtaaaaagttaaaaatgaagtttccacctaaaattccaaacagaaaaacaaaa
agcaagactaataaaggaggaataactcaaccaaacataaatgatagtctggaaattaca
aaattggactcttctatcatttcagaaggaaaaatatccacggtaacaccacagatccaa
gctttcactattcagaaagcagcagcagaaggtttgatgagccttcttcgtgatatgggg
aaaggttacttagctttgtgttcctataactgcaaagaagcgataaacatactgagccac
ctcccttctcaccactataatactggttgggtactgtgccagattggaagagcctacttt
gaactgtcagagtatatgcaggcagaacgaatattctcggaggtgagacggattgaaaac
tacagggtggagggcctggagatctattccacgacactttggcatcttcagaaagatgtt
gctctttcagttctttccaaggacttaactgacatggataaaaattcaccagaggcctgg
tgtgctgcaggaaactgtttcagtttgcaaagagagcatgatattgcaattaaattcttc
cagagagctatccaagttgatccaaattatgcttatgcctatacactgctgggacatgaa
ttcgtgctaacagaagaactagataaggcattagcctgttttagaaatgcaatcagagtc
aatcctagacattataatgcatggtatggattgggaatgatttattacaaacaagaaaaa
ttcagccttgcagaaatgcatttccagaaagcacttgatatcaaccctcagagttcagtt
cttctttgtcatattggagttgttcagcatgcattaaagaaatctgaaaaggctttggat
accttaaacaaggccatcattattgatcccaagaaccctctatgcaaattccacagagcc
tcagttttatttgcaaatgaaaaatataagtctgctttacaggaacttgaagaattgaaa
cagattgttcccaaagagtctctcgtttacttcttaataggaaaggtttacaagaagcta
ggtcagactcatctggccctgatgaatttctcctgggcaatggatttagaccctaaagga
gctaacaaccagattaaagaagcaattgacaagcgttatcttccagatgatgaggaaccc
ataactcaagaagaacagatcagtgagtgttatccatatgaatcagtgggaacagatgaa
tcccaagagagcagcatgacagacgcagatgacacacaacttcatgcagcagaaagtgat
gaattttaa

DBGET integrated database retrieval system