KEGG   Sarcophilus harrisii (Tasmanian devil): 100920472Help
Entry
100920472         CDS       T02286                                 

Definition
cell division cycle protein 27 homolog
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:shr04120]
Cellular Processes; Cell growth and death; Cell cycle [PATH:shr04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:shr04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:shr04914]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:shr05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 553 aa AA seqDB search
MQNKTFLDMANAAIWQALNHYAFRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAY
RLLKGHSCTTPQCKYLLAKCCVDLSNTTPQVLSPTIAAPPNALPRRSSRLFTSDSSTTKE
NSKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTVTPQIQA
FTIQKAAAEGLMSLLRDMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFE
LSEYMQAERIFSEVRRIENYRVEGLEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWC
AAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVN
PRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDT
LNKAIIIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLG
QTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDA
DDTQLHAAESDEF
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcagaataagacatttttggacatggctaatgctgctatatggcaagcactaaaccac
tatgctttccgagatgcagttttccttgcagaaagactgtatgctgaagtacactcagaa
gaagcattgtttttactggcaacctgttattatcgctcaggaaaggcatataaagcatat
agactcttgaagggacacagttgtactacaccacagtgtaaatatctacttgcaaaatgt
tgcgtcgacctcagcaatacaacacctcaggtattgagccccactattgctgctccaccc
aatgcactgcctcgaagaagctcacgactttttactagtgacagttctacaaccaaggag
aatagtaaaaagttaaaaatgaagtttccacctaaaattccaaacagaaaaacaaaaagc
aagactaataaaggaggaataactcaaccaaacataaatgatagtctggaaattacaaaa
ttggactcttctatcatttcagaaggaaaaatatccacggtaacaccacagatccaagct
ttcactattcagaaagcagcagcagaaggtttgatgagccttcttcgtgatatggggaaa
ggttacttagctttgtgttcctataactgcaaagaagcgataaacatactgagccacctc
ccttctcaccactataatactggttgggtactgtgccagattggaagagcctactttgaa
ctgtcagagtatatgcaggcagaacgaatattctcggaggtgagacggattgaaaactac
agggtggagggcctggagatctattccacgacactttggcatcttcagaaagatgttgct
ctttcagttctttccaaggacttaactgacatggataaaaattcaccagaggcctggtgt
gctgcaggaaactgtttcagtttgcaaagagagcatgatattgcaattaaattcttccag
agagctatccaagttgatccaaattatgcttatgcctatacactgctgggacatgaattc
gtgctaacagaagaactagataaggcattagcctgttttagaaatgcaatcagagtcaat
cctagacattataatgcatggtatggattgggaatgatttattacaaacaagaaaaattc
agccttgcagaaatgcatttccagaaagcacttgatatcaaccctcagagttcagttctt
ctttgtcatattggagttgttcagcatgcattaaagaaatctgaaaaggctttggatacc
ttaaacaaggccatcattattgatcccaagaaccctctatgcaaattccacagagcctca
gttttatttgcaaatgaaaaatataagtctgctttacaggaacttgaagaattgaaacag
attgttcccaaagagtctctcgtttacttcttaataggaaaggtttacaagaagctaggt
cagactcatctggccctgatgaatttctcctgggcaatggatttagaccctaaaggagct
aacaaccagattaaagaagcaattgacaagcgttatcttccagatgatgaggaacccata
actcaagaagaacagatcatgggaacagatgaatcccaagagagcagcatgacagacgca
gatgacacacaacttcatgcagcagaaagtgatgaattttaa

DBGET integrated database retrieval system