KEGG   Sarcophilus harrisii (Tasmanian devil): 100920472Help
Entry
100920472         CDS       T02286                                 

Definition
(RefSeq) cell division cycle protein 27 homolog isoform X1
  KO
K03350  
anaphase-promoting complex subunit 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100920472
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100920472
   04114 Oocyte meiosis
    100920472
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100920472
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100920472
Protein phosphatases and associated proteins [BR:shr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100920472
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100920472
Chromosome [BR:shr03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    100920472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
4
AA seq 526 aa AA seqDB search
MDKFRSNATQKLSVGRISQAGTKSVFSQSGNSREVTPILVAQTQSSGPQTSTTPQVLSPT
IAAPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDS
LEITKLDSSIISEGKISTVTPQIQAFTIQKAAAEGLMSLLRDMGKGYLALCSYNCKEAIN
ILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGLEIYSTTLWHL
QKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTL
LGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINP
QSSVLLCHIGVVQHALKKSEKALDTLNKAIIIDPKNPLCKFHRASVLFANEKYKSALQEL
EELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPD
DEEPITQEEQISECYPYESVGTDESQESSMTDADDTQLHAAESDEF
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggataagttcaggagcaacgctactcagaaattgtctgttggcagaatcagccaagct
ggaacaaagtctgtcttctcacagagtggaaatagtcgagaggtaactccaatccttgtt
gcacaaacacaaagttctggcccacagacaagtacaacacctcaggtattgagccccact
attgctgctccacccaatgcactgcctcgaagaagctcacgactttttactagtgacagt
tctacaaccaaggagaatagtaaaaagttaaaaatgaagtttccacctaaaattccaaac
agaaaaacaaaaagcaagactaataaaggaggaataactcaaccaaacataaatgatagt
ctggaaattacaaaattggactcttctatcatttcagaaggaaaaatatccacggtaaca
ccacagatccaagctttcactattcagaaagcagcagcagaaggtttgatgagccttctt
cgtgatatggggaaaggttacttagctttgtgttcctataactgcaaagaagcgataaac
atactgagccacctcccttctcaccactataatactggttgggtactgtgccagattgga
agagcctactttgaactgtcagagtatatgcaggcagaacgaatattctcggaggtgaga
cggattgaaaactacagggtggagggcctggagatctattccacgacactttggcatctt
cagaaagatgttgctctttcagttctttccaaggacttaactgacatggataaaaattca
ccagaggcctggtgtgctgcaggaaactgtttcagtttgcaaagagagcatgatattgca
attaaattcttccagagagctatccaagttgatccaaattatgcttatgcctatacactg
ctgggacatgaattcgtgctaacagaagaactagataaggcattagcctgttttagaaat
gcaatcagagtcaatcctagacattataatgcatggtatggattgggaatgatttattac
aaacaagaaaaattcagccttgcagaaatgcatttccagaaagcacttgatatcaaccct
cagagttcagttcttctttgtcatattggagttgttcagcatgcattaaagaaatctgaa
aaggctttggataccttaaacaaggccatcattattgatcccaagaaccctctatgcaaa
ttccacagagcctcagttttatttgcaaatgaaaaatataagtctgctttacaggaactt
gaagaattgaaacagattgttcccaaagagtctctcgtttacttcttaataggaaaggtt
tacaagaagctaggtcagactcatctggccctgatgaatttctcctgggcaatggattta
gaccctaaaggagctaacaaccagattaaagaagcaattgacaagcgttatcttccagat
gatgaggaacccataactcaagaagaacagatcagtgagtgttatccatatgaatcagtg
ggaacagatgaatcccaagagagcagcatgacagacgcagatgacacacaacttcatgca
gcagaaagtgatgaattttaa

DBGET integrated database retrieval system