KEGG   Sarcophilus harrisii (Tasmanian devil): 100920512Help
Entry
100920512         CDS       T02286                                 

Gene name
BCMO1
Definition
beta-carotene 15,15'-monooxygenase 1
Orthology
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100920512 (BCMO1)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.36  beta-carotene 15,15'-monooxygenase
     100920512 (BCMO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 533 aa AA seqDB search
MDMIFGKNKKEHPEPLRAKIRGELPTWLHGTLLRNGPGMHTIGETTYNHWFDGLALLHSF
TIQNGEVHYRSKYLRSDTYNSNIEANRIVISEFGTMAYPDPCKNIFSKAFSYLSHTIPDF
TDNCLINIMKCGEDFYATTETNYIRKINPETLDTLEKVDYRNYANINVATSHPHYDAQGN
VLNLGTSIVDKGKTKYLVFKIPPTIPEKKKKKNNLKHLEVICSIPSRSLLNPSYYHSFGI
TENYIIFLEQPFKLDILKMATAYIRGTNWASCLTFHEEDKTYIHIIDRKTKRTLQTKFYA
DPMVVFHHVNAYEEENHIVFDVISYKDHSLYQLFYLANLNQFFEQNSKLTSTPTLKRFVI
PLQMDKDAEIGENLVKLESTTATALKEKDDQVYCQSEELCEGIELPRINYAYNGKKYRYI
YAAEVQWNPVPTKILKFDILTKSSLKWAEEHCWLAEPVFVPAPNAQQEDDGIILSVVIST
DSKKSPFLLILDAKRFTELARASVDVEIHLDLHGLFIPSGDSPEEQEGNVLRN
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggatatgatctttggcaagaacaagaaggaacatccagagcctttgagagccaaaatt
agaggtgagctgccaacttggcttcatggtactcttctacggaacggccctggcatgcac
accattggggagactacttataatcattggttcgatggtttggccttattacatagtttt
accattcaaaacggtgaagttcattaccgaagtaaatacctccgaagtgacacatacaat
tccaatattgaagccaacaggattgtgatatcagaatttggaactatggcttatccagat
ccttgcaaaaatatattttccaaagctttttcctacctatcccacactattccagacttc
accgataattgcctcatcaatatcatgaaatgtggggaggacttctatgctactacagag
acaaattatattaggaaaatcaatccagaaactctggataccttggagaaggttgattac
cgtaattatgcaaacataaatgtggcaacttctcatcctcactatgatgctcaagggaat
gtcctcaacttgggcacatccatcgttgacaagggaaaaactaaatatttggtgtttaag
atacctcccacaataccagagaaaaaaaagaagaaaaataacttaaaacacttggaagtc
atctgttccatcccatctcgctctcttctcaacccaagctactaccacagttttggaatt
actgaaaactacatcattttcctagagcagccctttaagttggatattttaaagatggcc
actgcctacattcgaggcacaaactgggcttcttgccttaccttccacgaagaagacaag
acttacattcacattattgatcgaaagacaaaacggaccctgcagaccaaattttatgct
gatcccatggttgtcttccatcatgtaaatgcctatgaagaagagaatcatatcgtgttt
gatgtcatttcctataaggaccacagtctttatcagctcttctacttggcaaacttgaat
caattctttgagcagaactctaaacttacttctacaccaaccctcaagagatttgtcatt
cctctccagatggacaaggatgcagaaataggtgagaatttagtcaaacttgaatcgaca
acagcaactgctctgaaggaaaaagatgaccaagtctactgccaatcagaagagctatgt
gaagggattgagctgccccgtattaactatgcttacaatgggaaaaagtacagatacatt
tatgcagcagaagtacagtggaatccagttccaacaaagatattgaaatttgatattctg
acaaagtcatcattgaaatgggcagaggagcactgttggcttgctgagcccgtgtttgtg
cctgcaccaaatgcacaacaagaagatgatggtattatattgtcagtggttatctccacc
gactccaagaaatcaccttttctgctgatattggatgcaaaacgatttacagaactggct
cgggcatcagttgatgtggaaatacatttggatctacatgggctattcattccctctggg
gattcgcctgaagagcaggagggcaatgtgcttaggaactaa

DBGET integrated database retrieval system