KEGG   Sarcophilus harrisii (Tasmanian devil): 100920538Help
Entry
100920538         CDS       T02286                                 

Gene name
CLTCL1
Definition
(RefSeq) clathrin, heavy chain-like 1
  KO
K04646  
clathrin heavy chain
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:shr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100920538 (CLTCL1)
   04142 Lysosome
    100920538 (CLTCL1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100920538 (CLTCL1)
  Nervous system
   04721 Synaptic vesicle cycle
    100920538 (CLTCL1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100920538 (CLTCL1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100920538 (CLTCL1)
Exosome [BR:shr04147]
 Exosomal proteins
  Proteins found in most exosomes
   100920538 (CLTCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1758 aa AA seqDB search
MAPPGAPGHWGKAAIERKLEVLWVGVEEEAPSPNAQRQTQRLPPGRNVCPPCKFVGSGLA
RVDIDPGGDQDGAAERFRSHWSAAALARAETHGRSPEEGPQGGGARGERGVYRGASARDG
APACSVLLRGCLLLIQCTSGKTLQIFNIEMKSKVKAHTMAEEVTFWKWISVNTVALVTDA
AVYHWSMEGDSQPLKMFDRHASLAGCQIINYRTDEHQKWLLLIGISAQQNRVVGAMQLYS
VDRKVSQPIEGHAAAFAEFKVEGNSKSSTLFCFAVRNPTGGKLHIIEVGQPAAGNQPFVK
KAVDVFFPPEAQTDFPVAMQIGIKHGVIYLITKHGYIHMYDLESGVCIYMNRISADTIFV
TTPHEPTSGIIGVNKKGQVLSICVEEDNIVNYATSVLQNPDLGLRMAIRSNLAGAEELFA
RKFNTLFAQGSYAEAAKVAASAPKGILRTSDTIRKFQSVPAQPGQASPLLQYFGILLDQG
QLNKFESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKATDPTLALSVYLRASVP
TKVIQCFAETGQFQKIVLYAKKVAYTPDWIFLLRSVMRVSPEQGLQFAQMLVQDEEPLAN
INQIVDVFMENSLIQQCTSFLLDALKNNRPAEGHLQTRLLEMNLIHAPQVADAILGNQMF
THYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSVEDSVE
CLRAMLAANIRQNLQLGVQVASKYHEQLGTQTLVELFESFKSYEGLFYFLGAIVNFSQDP
DVHFKYIQAACKTGQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCDRFDFVH
DLVLYLYRNNLQKYIEIYVQKVNPSRIPAVVGGLLDVDCSEDVIKNLIMVVRGQFSTEDL
VAEVEKRNRLKLLLPWLESRTHEGCEEPATHNALAKIYIDSNNNPERFLRENPYYDSRVV
GKYCEKRDPHLACVAYERGQCDLELIQVCNENSLFKSEARYLVRRKDPELWANVLEENNP
FRRQLIDQVVQTALSETQDPEEVSVTVKAFMTADLPSELIELLEKIVLDNSVFSEHRNLQ
NLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELYEEAFAIFRKFDVNTSAIQVL
IEHIGNLDRAYEFAERCNEPAVWSQLARAQLQKDLVREAIDSYTKADDPSSYLEVVEAAS
RNGNWEDLVKFLHMARKKGRESYVETELIFALAKTNRLSELEEFINGPNNAHIQQVGDRC
YEEAMYEAAKLLYSNVSNFARLASTLVHLGEYQAAVDSSRKANSTRTWKEVCFACVDGQE
FRLAQLCGLHIVIHADELEELISYYQDRGYFEEVIALLEAALGLERAHMGMFTELAILYS
KFKPQKMREHLDLFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAITTMMAHPTEA
WKEGQFKDIITKVANVELYYKALRFYLDYKPLLINDLLLVLSPRLDHTRTVRFFSKVNQL
PLVKPYLRSVQNHNNKGVNEALNNLLTEEEDYQGLRASIDAYDNFDNIRLAQRLEKHQLM
EFRRIAAYLYKGNNRWRQSVELCKKDRLYKDAMQYAAESRDAELAEGLLQWFLEEGKREC
FAASLFTCYDLLHPDVVLELSWRHSIMDFAMPYFIQVMREYLTKVDKLDASESLRKDEEQ
GAEPTPIVFASRTRDGGGGRGLTAHGGRSQGALPGHERSRCRLRPLTAGPTSGPSQTNFS
YGYTAPGFTQAPVYSFNM
NT seq 5277 nt NT seq  +upstreamnt  +downstreamnt
atggctcctccgggagctcctggtcactggggaaaggcggcaattgaaaggaagcttgag
gtgctgtgggtgggggtggaggaggaggcgcccagcccaaatgcacagcggcaaacccag
aggctgccaccgggaagaaacgtgtgcccgccttgcaagtttgtgggctcgggcctagcg
cgtgtggacattgatcctggaggtgaccaagatggggcggccgagcgctttaggagtcac
tggtcagcggctgccttggcacgggcagagacccatggccggagcccagaggaggggccc
cagggcgggggtgccaggggagagaggggggtgtatcggggagcttctgcccgggatggg
gctccagcgtgctctgttctgctacgtggttgtctgctgttaatccagtgcacgtcggga
aagaccctccagattttcaacattgagatgaagagcaaagtgaaagcgcacacgatggca
gaggaggtgaccttctggaaatggatttccgtcaacaccgttgccttggtgaccgacgcg
gccgtctaccattggagcatggagggagactcgcagcccctgaagatgtttgaccgacac
gcgagcctggctgggtgccagatcatcaactacaggaccgatgagcaccagaagtggctt
ctgctgatcggcatctctgcccagcaaaaccgtgtggttggcgccatgcagctttactca
gtggacaggaaggtgtcacagcccatagaaggccatgccgcagctttcgccgagttcaaa
gtagaggggaactccaagtcttccactcttttctgtttcgctgtacggaatcccaccggt
ggcaagctgcacatcatcgaggtgggccagcccgcggccgggaaccagccctttgtgaag
aaagccgtggatgtgttctttcctcccgaggcacagacggatttcccggtggccatgcag
attggaatcaaacacggcgttatttacttgattacaaagcatggctatatccacatgtat
gacttagagtccggagtgtgcatctacatgaaccgtatcagcgccgataccatcttcgtc
acgactcctcacgagcccacctctgggatcattggggtgaacaagaaagggcaggtcttg
tccatctgtgtggaagaagataacattgtcaattatgctaccagtgtgctccagaatccc
gacctcggtctgcgcatggccattcgcagcaacctggcaggagccgaggagctctttgcc
cgaaagttcaataccctctttgcgcagggcagctacgccgaagccgccaaagtggctgct
tccgcacccaaggggatcctgcgcaccagcgacaccatccggaagttccagagtgtcccg
gcccagcccgggcaggcctcccccttgctccagtatttcgggatcttgctggaccagggg
cagctgaacaagttcgagtctctggagctctgccggcctgtccttcagcagggtcgcaag
cagctcctggagaaatggcttaaggaggacaagttggagtgctccgaagagctgggggac
ctggtgaaggccacggacccgacgctggcgctcagtgtctacctgcgggcgagtgtgccc
accaaggtgatccagtgcttcgccgagacgggccagttccagaagatcgtgctctacgcc
aagaaggtcgcctacacgcccgactggatcttcctgctgaggagtgtgatgagggtcagc
ccagagcagggcctgcagttcgcccagatgttggtgcaggatgaggagccattggccaac
atcaatcagatcgtggacgtcttcatggagaacagcctgattcagcagtgcacgtccttc
ttgctggacgccttgaagaacaatcgcccggcagaaggccacctgcagacccgcctcctg
gagatgaacctgatccacgccccccaggtcgcggacgccatccttggcaatcagatgttt
acccactatgaccgtgcccacatcgcccagctctgcgagaaggcggggctgctgcagcgg
gcgctggagcactacacggacctgtacgacatcaagcgggccgtggtgcacacccacctc
ctgaatcccgagtggctcgtgaacttcttcggctccctgtcggtggaggactccgtggag
tgcctgcgggcgatgctggcggccaacatccggcagaacctgcagctgggcgtgcaggtg
gcctccaagtaccacgagcagctcggcacccagaccttggttgagctcttcgagtccttc
aagagttacgaaggcctcttctacttcctgggcgcgatcgtcaacttcagccaggatccg
gacgtgcatttcaagtacattcaggccgcctgtaagaccgggcagatcaaggaggtggaa
agaatatgccgggagagcaactgctacaaccctgagcgggtgaagaacttcctcaaggag
gccaagctgaccgatcagctgcccttgatcattgtctgcgaccgatttgactttgtccac
gacctggtcctgtatctgtaccgcaacaacctgcagaagtacatcgagatctacgttcag
aaggtcaaccccagccggattcccgccgtggtcggagggctgctcgatgtggattgctcg
gaagacgtcatcaaaaacttaatcatggtggtgaggggacagttctccaccgaggacttg
gtggctgaggtggagaaaagaaacaggctgaagctgctgcttccttggctggagtcccgg
acccacgagggctgcgaggagccggccacccataatgccctggccaagatctatatcgac
agtaacaataaccccgagcgcttcctccgcgagaacccctactacgacagccgggttgta
ggtaaatactgtgaaaagagggacccgcatttggcctgtgttgcctatgagagggggcag
tgtgacctcgaactcatccaggtttgtaacgagaattctctgttcaaaagtgaagctcgt
tacctggtacgcagaaaagacccagagctctgggccaatgtcctggaggagaacaaccca
ttcaggaggcagctcatcgatcaggtggtgcagacggccctgtctgagacccaggacccc
gaggaggtctcggtgactgtgaaagccttcatgacggccgacctgcccagcgagctcatc
gagctcctcgagaagatcgtcctagacaactctgtgtttagcgagcacaggaatctgcag
aacctcctgattttgaccgccatcaaggctgaccgcacacgcgtcatggagtacatcaac
cggctggataactacgacgcccccgacatcgccaacatcgccatcagcaacgagctctac
gaggaggccttcgccatcttcaggaagttcgatgtgaacacgtcagccatccaggtgctg
atagaacacatcggcaacttggaccgcgcctacgagtttgcggaaagatgcaacgagcct
gctgtatggagccagctggcccgagcccagctgcagaaggacctggtgagggaggccatc
gactcgtacaccaaggcggacgatccctcctcctacctggaggtcgtggaggctgccagc
agaaacggcaactgggaagatctagtgaaatttctacacatggccaggaaaaagggccga
gagtcatacgtggagaccgaacttattttcgctttggccaaaaccaaccggctctcggag
ttggaggagtttatcaatggccccaacaacgcccacatccagcaggttggtgaccgctgc
tacgaggaggccatgtacgaagccgccaagctgctctacagcaacgtgtccaactttgcc
cgcttggcgtccaccctggtgcatctgggcgagtatcaggccgccgtggacagcagtcgc
aaggccaacagcaccaggacctggaaggaggtgtgttttgcctgtgtggacggccaggag
ttccgcctggcccagctgtgtggcctccatatcgtcatccacgcagatgagctcgaggag
ctgatcagctactaccaggatcggggctatttcgaggaagtgatcgccctgttggaggct
gccctgggcctggagcgggcccacatgggcatgttcactgagctggccatcctgtactcc
aagttcaagccacagaagatgcgagagcacctggacctcttctggtcccgagtcaatatt
cccaaggtcctgagagcggctgagcaggcccatctctgggccgagctcgtgttcctctac
gacaagtacgaggagtacgacaacgccatcaccaccatgatggcccaccccaccgaggcc
tggaaagaagggcagttcaaggacatcatcaccaaggtggccaatgtggaactgtactac
aaagccctgcgcttttacctggattacaagcccctcctgatcaacgacctcctgctggtt
ctctcgccccggctggatcacactcgcaccgtcaggtttttctctaaggtgaatcagctg
cctctggtgaaaccttacctgcgttcggtccagaaccacaataataagggagtaaatgag
gctcttaataacctgctgactgaggaagaggattaccagggcttgagggcatctattgat
gcttacgataactttgacaacatccgtctggctcagcgactggagaagcaccaactgatg
gagttcaggcgcatcgcggcctatttgtacaaaggcaataaccggtggagacagagcgtg
gagctctgcaagaaagaccgtctctataaggacgccatgcagtacgcggccgagtcccgg
gacgccgagctggccgagggcctgctgcagtggttcctggaggaggggaagcgggaatgc
tttgctgcttctctcttcacctgctatgatctcctgcaccctgatgttgtcctcgagctc
tcctggaggcacagcatcatggactttgccatgccctactttatccaggtgatgagggaa
tatcttaccaaagtagataaactggacgcttctgagagcctgaggaaagatgaggagcag
ggcgccgagcccacccctattgttttcgcgtcccggacgagggatggtggtggtggtcgg
ggcctgacggcgcacggaggccgaagccagggagctttgccagggcatgagcggtcccgg
tgccggctccgtcctttgacggcaggccccacttctggaccttcccaaaccaacttttcc
tacggatacacggctccaggattcacccaggcacccgtttacagcttcaacatgtaa

DBGET integrated database retrieval system