KEGG   Sarcophilus harrisii (Tasmanian devil): 100920653Help
Entry
100920653         CDS       T02286                                 

Gene name
LYZ
Definition
lysozyme
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:shr00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    100920653 (LYZ)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100920653 (LYZ)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100920653 (LYZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 147 aa AA seqDB search
MKVLLLLGFIFLPMAVHGKIFERCDFARRIKELGMDNYHRVSLANWVCLAKWESSFNTKA
RNYNPGDKSTDYGIFQTNSHYWCDDGKTPHATNGCGYKCSELEEDNLIKAVKCAKKIVDQ
QGITAWVAWRNKCQGKDLSGYLKGCKL
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtactccttcttctggggttcatcttccttcccatggcagtacatggtaaaatc
ttcgagagatgtgattttgccagaagaataaaggaactgggcatggataactaccataga
gtcagcctggctaactgggtgtgcttggcaaagtgggagagcagttttaataccaaagca
agaaactacaaccctggagataaaagcactgattatgggatatttcagaccaacagtcac
tactggtgtgatgatggcaagaccccacatgcaaccaacgggtgtggctacaagtgctca
gaactggaggaagataacctcattaaagcagtaaagtgtgcaaaaaagattgtagatcaa
caaggcattactgcatgggtggcctggagaaacaagtgccaaggaaaagacctttcagga
tacctgaaaggttgcaaactgtaa

DBGET integrated database retrieval system