KEGG   Sarcophilus harrisii (Tasmanian devil): 100920702Help
Entry
100920702         CDS       T02286                                 

Gene name
USP42
Definition
(RefSeq) ubiquitin specific peptidase 42
  KO
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100920702 (USP42)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100920702 (USP42)
Ubiquitin system [BR:shr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100920702 (USP42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1400 aa AA seqDB search
MTIVDKVSESSNPSACQNQPGSSVAPSLGDMDSGSASWGAVSSLTDIPKHKISLGPVPGA
AIYSNSSISDKPKPSAQKDQSTGDGIAPPQKVLFPAEKICLKWQQSHRVGAGLQNLGNTC
FVNAALQCLTYTPPLANYMLSHEHSKICHEQGFCMMCTMQAHITQALNNPGNVIKPMPVI
NDLRRIAKHFRFGNQEDAHEFLRYTVDAMQKACLNGSTKLDRHSQATTLVCQIFGGYLRS
RVKCMNCKGVSDTFDPYLDIPLEIKAAQSVNKALEQFVKPEQLDGENSYKCSKCKKMVPA
SKRFTIHRSSNVLTLSLKRFANFSGGKIAKDVKYPEYLDIRPYMSQPNGEPIIYVLYAVL
VHTGFSCHAGHYYCYIKASNGQWYQMNDSIVSTSDIRSVLNQQAYVLFYIRSHDVKNGGE
HTHSIHTPGQSSPRPVINQRVVNNKQTVSGFIGPQLPPHMIKNSNHLNGTGPLKETPSCS
VASASNSNLNRTSPASASTSIQNWTVNRPSIIPEPPKKQKITISIHNKLPVRQGQSQPNL
HNSSLENLSKSIPSSTITNSSALQSTSNASTMSVATKVSKQITPSESCSKPVMNGKSKLT
SSVLVPYGAESSEESDEESKGLGKENGHAKPLNGLLTGNGISILPNACSSCQDAEDDEAS
HHELPETVTVNGANSIENSEPKENGLSFDDPTCQVKPAKHSENPFSKTNGLHGKLMPTPL
PPLPEDRIVESFRFNNKLKSLTDDISSSGNEKPPEEELGTELVVGSSSSASYEQLDKVTS
SLSCKIKNTFPPSDPNVIATKEEITESIIAKPEESIPNIISHCNANKKTIGDDQFPKQCD
PGNFTDEKIILSQEIKGTVKENSLNSAAVDTMEKLSQTPSNNFDTECDSNKLLVFISTEK
CKETKDLSKSIDMSTNELSATQLDKIIENHYSKGSTEQNNSERCEENKVRQKVQSNSPVK
EKGNSPRKADKGHHHNRRDRSSSGERTKQSRSKTENHYYKKRVSYSKERTKKSRHKSEHC
NGSKYKPFHNESSSPDSRSLGKHNHYQSRSRGKSDQERGRYYHSKSERSWSREKYYPDGV
RRWDKYRYYNDYYSYSSRDGREWKPSHSDREYDKASQYNNRSHKDYYKSKWVHEPAPKEK
ERHHSNSNKVDLSHCSSLPQHPEKYSHDKIALEENSSNLCSQFHEHDIVKMRKRKYDSIE
NDSDLEKKIPKPLQNEPVEEQKVKKHKKSKKKKKSKDKHRARSCKHHQDLDLSVANSKAD
LRKHKKKKKKKKKHAKKLEDYIEHSDLHVLKASCSETDNKIWEKKDKSPIKDGLPSEDYQ
KSNKLSHEEDDDHPEKTKHLRMESQDHKCHPAEYGQAKDLPSHKDYSQKFSSKQLDDSST
STDESRWKVNENSSSKEKLH
NT seq 4203 nt NT seq  +upstreamnt  +downstreamnt
atgactatagttgacaaagtatctgaatcttccaacccatcagcttgtcagaatcaacct
ggcagctctgtggcaccttcactcggagacatggactcaggctctgcaagttggggagct
gtatcttctttgacagacatccccaaacacaaaatttctttaggaccagtacctggtgct
gcaatttattctaattcatctatttccgacaaaccaaagccatcagcacagaaggatcaa
tctacaggtgatggcattgcacctcctcagaaggtcctttttccagccgaaaaaatttgc
ctaaagtggcaacaatctcatagagttggagctgggctccagaatctgggcaatacgtgt
tttgtcaatgctgcactgcagtgtttaacatatacgccacctcttgccaactatatgtta
tctcatgaacactccaaaatatgccatgagcaaggattctgtatgatgtgtaccatgcag
gcccatattacacaggcactcaataatcctggtaatgtcatcaaaccaatgccagttatc
aatgatcttcgacgtatagctaaacacttccgttttggaaaccaggaagatgcccatgaa
tttcttcgatacactgttgatgcaatgcagaaagcatgcctgaatggcagcactaaattg
gaccggcactcccaggctaccacacttgtttgtcaaatatttggaggctatctgagatct
cgagtaaagtgtatgaactgcaaaggagtttctgatacctttgatccataccttgatatt
ccattggaaataaaggctgcccagagtgtcaacaaagccttggaacaatttgtgaagcct
gagcaattagatggagaaaattcctataaatgtagcaagtgtaaaaagatggttccagct
tcaaagaggtttactatacatagatcatctaatgttcttaccttatctttgaaacgtttt
gcaaatttcagtggtggaaaaattgccaaggatgtgaaatatcctgagtatctcgatatt
cgaccatatatgtctcaacctaatggagaaccaattatttatgttctatatgcagtgtta
gtgcatactggttttagctgtcatgctggtcattactactgttacataaaggctagtaat
ggacagtggtaccagatgaatgactccattgtttctaccagtgatatcagatcagtgctt
aaccagcaagcctatgtcctcttttatatcagatcccatgatgtaaaaaatggaggggaa
cacactcattccattcatactccaggacagtcttctcctcgaccagtgatcaatcaacgg
gtagtcaataataaacagactgtgtcaggttttattggaccacaacttcctcctcatatg
ataaagaattctaatcacttaaatggaactggaccattgaaagaaactccaagctgttct
gtggcaagtgctagtaattctaatttaaacagaacaagtcctgcttctgcttcaacttct
attcaaaactggacagttaacagaccctcaattattcctgagcctcctaagaagcaaaaa
atcactatcagtattcataataagttgcctgttcgacaaggtcagtcccaacctaatctt
cacaatagttctttagaaaacctcagcaagtccattccctcatctaccattactaattct
tctgcattacaatctacctcaaatgcatctacaatgtcagttgctactaaagtatcaaaa
cagatcacacctagtgaatcttgttccaagccagtaatgaatggcaaatccaagctcacc
tccagtgtgctggtcccttatggtgcagagtcttcagaagaatctgatgaggagtcaaag
ggattgggtaaggagaatggccatgcaaaacctcttaatggacttctgactggaaatgga
atcagtatactcccaaatgcttgttcttcctgtcaagatgctgaagatgatgaggcttct
catcatgaactgccagaaactgtgacagtaaatggtgctaatagtatagagaatagtgaa
cctaaagaaaatggactatcatttgatgatcccacttgccaagtcaagcctgctaaacat
tcagaaaatcccttttctaagacaaatggattacatggaaagttgatgcctactcctttg
cctccactcccagaagacagaattgtagagtctttcagattcaacaacaaattaaaaagt
ttgactgatgatataagttcaagtggaaatgagaaaccacctgaagaagaacttggtaca
gaacttgtggttggtagcagcagttcagcttcctatgaacagctagataaagttacttcc
agtcttagctgcaaaataaagaatacctttccaccttcagaccctaatgtcattgctacc
aaagaagaaattactgaaagtattatagcaaaaccagaagaatctattcccaatatcatt
agtcattgtaatgctaacaagaaaaccattggagatgatcagtttcctaaacagtgtgat
cctgggaatttcacagatgaaaagatcatattatcccaagaaataaagggaacagtaaag
gagaattctctgaactctgcagcagtggacacaatggaaaaattgagccaaactccttcc
aataattttgacactgaatgtgatagtaataaactcttagtatttattagtactgaaaaa
tgcaaagaaacaaaggacctttctaaaagtatagacatgtctactaatgaactgtctgct
acccagttagataaaattatagagaatcattattcaaaagggagcactgaacaaaataat
agtgaacgatgtgaagaaaataaagttagacaaaaagttcaaagtaattctccagttaag
gaaaaaggtaatagccctagaaaagcggacaaagggcatcatcataaccgaagagatcgt
tcatccagtggagaacgaacaaagcaaagcaggagcaaaacagagaaccattattacaaa
aaaagggtgtcttatagcaaagagaggaccaaaaagagccgccacaaatcagaacactgt
aatggaagcaaatataaaccttttcataacgaaagcagcagccctgacagtagatcctta
ggaaaacataaccattatcagtccagaagtagaggaaaatctgatcaggaaaggggtaga
tattatcattctaaaagtgaacgatcttggagtcgggagaaatattatccagatggagta
agaagatgggacaaatatagatattataatgattattattcttattcttcaagagatggt
agagagtggaagccatctcacagtgatcgagaatatgacaaagcaagtcagtacaataat
agatcacacaaggactattataaaagcaaatgggttcatgagccagcacctaaagagaaa
gaaaggcatcactcaaacagtaataaagtagatctatcccattgttcctctcttcctcaa
catcctgaaaaatactctcatgacaaaattgcacttgaagaaaatagttcaaatctttgt
agtcaatttcatgagcatgacattgtaaaaatgaggaaaaggaaatatgatagtatagaa
aatgacagtgacttagaaaagaaaatccccaaacccttgcaaaatgagccagtagaagag
cagaaagttaagaagcacaaaaaatcgaaaaagaaaaagaaatccaaagacaaacacaga
gctcgaagttgcaagcatcatcaggatttggatctttctgtagccaactccaaagctgac
cttcgcaaacacaaaaagaagaagaagaaaaagaagaaacatgcaaaaaaattagaggac
tatattgaacattcagatcttcatgtactcaaggcttcctgctctgagactgataacaaa
atctgggagaaaaaggacaaatctcccatcaaagatggcttgccatctgaggactaccag
aaatctaataaactttctcatgaggaagatgatgatcaccctgagaaaaccaaacactta
agaatggaaagccaggatcataaatgtcacccagctgagtatggccaggctaaagacctc
ccctctcataaggactacagtcagaagttttccagtaaacagttggatgacagttctaca
agtacagatgaatctagatggaaagtgaatgaaaactcatcctcaaaagaaaaattacac
tag

DBGET integrated database retrieval system