KEGG   Sarcophilus harrisii (Tasmanian devil): 100920760Help
Entry
100920760         CDS       T02286                                 

Gene name
RASGRF1
Definition
Ras protein-specific guanine nucleotide-releasing factor 1
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100920760 (RASGRF1)
   04010 MAPK signaling pathway
    100920760 (RASGRF1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100920760 (RASGRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1259 aa AA seqDB search
MQKGIRLNDGHVTYLGLLAKKDGTRRGYLSKRSSDNTKWQTKWFALLQNLLFYFENDSSS
RPSGLYLLEGCVCDRAPSPKPSLSGKEPLEKQHYFTVNFNHENQKTLELRTEDAKDCDEW
VAAITHASYRNLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEIAS
LLKDNDRIQSIQTVTPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLMEEQESTDEENKTSG
QDIDHLDFKIVVEPKDCPSFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVGRLLERLTDLRFLSIDFLNT
FLHSYRVFTTAVVVLDKLITIYKKPISAIPARSLELLFASGQNNKLLYGEPPKSPRANRK
FSSPPPLSITKSSSPSRRRKLSLNIPIITGGKALDLAALSCSSNGYASMYSSMSPFSKTT
LDISKSYVFSNFPNKIPDEGENTTEKIEDSSPNKLSKESTEVSVREESDNDQNQSDDADT
ETSPTKSPTTPKSIKSKNASEFSLFSYNNGVVMTSCRELDNNRSALSAASAFAIATAGAN
EGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDE
LKFKVISFLEEVIHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEIVQMAEGVKAEPF
ENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKVEKNERTPYIMKTTKHFNDISNLIA
SEILRSEDVNARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQ
TKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVN
FSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPKLPT
NT seq 3780 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaggaatacggttgaatgatggccatgtaacctacctggggctgttggcaaag
aaagatggcacaagaagaggttatctgagcaagagaagctcagataacacaaaatggcaa
acgaagtggttcgctttgctgcaaaaccttcttttctactttgagaatgattccagttcc
agaccctcgggattgtacctgttggagggctgcgtgtgtgaccgggcaccgtctcccaag
ccgtccctctcaggaaaggaaccgctggagaaacagcattatttcacggttaacttcaat
catgagaatcagaaaaccctagaattgagaacagaagatgctaaagattgtgacgaatgg
gtggccgcaataactcacgcaagttacaggaacttggccacagaacatgaagctttaatg
cagaagtatctccatttgcttcaaattgtggaaacagagaaaacagttgccaaacagctg
cgacaacagatcgaagatggggagattgagattgaacggctgaaatcagagattgcctcc
ttgctcaaggacaatgaccgaattcaatcaatccaaactgtcacacccaatgatgaagac
agtgacatcaagaaaattaagaaggtgcaaagctttttgcggggctggctctgccggaga
aaatggaagacaattattcaggactatatccggtcacctcatgctgacagcatgcggaaa
agaaaccaagtggtatttagcatgcttgaggcagaagctgaatatgtccagcaactgcac
atcttagtcaataacttcctccgtcccttgaggatggctgccagctcaaaaaagcctcct
attacacatgatgatgtcagcagcatcttcctaaatagtgaaacaatcatgtttttgcat
cagattttttaccaaggcctcaaagcccggatatccagctggccaacattagtgcttgct
gacctatttgacatactgctgcctatgctgaatatttaccaggagtttgtgagaaaccat
caatacagtttgcagatcctagctcactgcaaacagaacagggattttgacaaactcctg
aagcattatgaagcaaagcctgactgtgaagagagaactctggagacctttctcacttat
cctatgtttcagattcccagatatattctaacattacatgaactcctggcacacactccc
catgagcacgtggagcgcaacagtttggattatgcaaaatcaaaactagaggaattgtcc
agaataatgcacgacgaagtgagtgaaactgagaacattcggaaaaatctggcaattgaa
agaatgatcatagaagggtgcgaaattctcctggacaccagccaaacttttgtgagacaa
ggttccctcatccaggtgcctatgtctgaaaaaggaaaaataacaagaggacgcctgggg
tcattgtccttaaagaaagagggagagagacaatgctttctgttttctaaacatttaatt
atctgcactagaggctctggtggaaagctacacttgacaaagaatggagtgatctcactc
attgactgtaccttgatggaagagcaagaaagtacagatgaagaaaataaaacctctgga
caagatatagatcacttggattttaagattgtggtggagccaaaagactgtccgtctttc
actgtcatccttgtggcctcctccagacaagagaaagctgcctggacaagtgacattagt
cagtgtgtagataatattagatgcaatggcctcatgatgaatgcttttgaagaaaactcc
aaagtcaccgttcctcaaatgatcaagtcagatgcctccctatactgtgatgacgttgac
atacgattcagcaaaaccatgaactcctgtaaagtcctgcagattcgttatgccagtgta
gggcgacttctagaaagactcacagacctacggttcctgagcatagattttctgaacaca
ttcttgcattcctatagggtgttcacaacagctgtggtggtcctggacaaactcatcacg
atttataagaaacctatcagtgcaatacctgcaagatcactggagctcttatttgccagc
ggccaaaacaacaaacttctgtatggagaacctcccaagtccccaagagctaatcgcaag
ttctcctccccaccacctttgtccatcaccaagtcatcttcaccaagtagaagacgaaag
ctttccttaaacatccctatcatcactggagggaaggctttggatctagctgctttaagc
tgctcttcaaatggctatgcaagcatgtattcttctatgtcaccctttagtaagaccacg
ctggatatcagcaaatcatatgttttcagtaactttcctaataagatacctgatgagggt
gaaaatacaactgaaaaaatcgaagactcaagtcccaacaaactaagtaaagaaagcaca
gaagtttctgtaagagaagagtcagataatgatcaaaatcaaagtgatgatgcagacaca
gaaacttcaccaactaagtctccaactactccaaaatcaatcaaaagcaaaaatgcttca
gaattttcactattttcttataataatggagttgtgatgacttcttgtcgagaactggac
aataaccggagtgccctttcagccgcctcagcttttgccatagcaactgctggagccaat
gagggcacacctaacaaagagaagtacagaaggatgtcattagcaagtgcaggcttcccc
cctgaccaaaggaatggagataaagaatttgtgataaggagagctgcaaccaaccgagta
ttgaatgtccttcgacactgggtctcaaagcattctcaggattttgaaaccaacgatgag
ctaaaatttaaagttattagttttctggaagaagtcattcatgaccctgaacttttgacc
caagaaagaaaagcagctgccaatattataaggactttgacacaggaagacccaggagac
aaccagatcacactggaagagattgtacagatggctgaaggagtgaaagcagaacctttt
gaaaaccactctgctttggaaatagctgaacagctgactctactggaccacctggtcttt
aagaagattccatatgaagagttttttggacaaggctggatgaaggttgaaaagaatgaa
agaactccttacatcatgaaaactaccaagcattttaatgatatcagtaacctgatagct
tcagaaatcctccgaagtgaggatgttaatgcccgagttagtgccattgaaaagtgggtg
gctgtggctgacatctgccgatgcttacacaattacaatgctgtgctagaaatcacctcc
tccatgaaccgtagtgccatcttcagattgaagaaaacatggctgaaagtctccaaacag
acaaaagctttgattgataaactccaaaaacttgtgtcatcagagggcagatttaagaat
ctgagagaagctctgaaaaattgtgacccaccttgtgttccatatcttggaatgtacctc
actgatttggcattcatagaagaaggaacacccaattatacagaggatggcttggtaaac
ttctccaaaatgaggatgatatcccatattatcagagagatccgtcaatttcaacaaaca
gcctacaaaatagaacaccaagcaaaggtaacacaatatttactggaccaatcttttgta
atggatgaagaaagcctttatgaatcctctctacgaatagaacccaaattaccaacctga

DBGET integrated database retrieval system