KEGG   Sarcophilus harrisii (Tasmanian devil): 100920935Help
Entry
100920935         CDS       T02286                                 

Gene name
PDIA3
Definition
protein disulfide isomerase family A, member 3
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Protein processing in endoplasmic reticulum
Antigen processing and presentation
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:shr04141]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:shr04612]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 506 aa AA seqDB search
MAMRRRLALLPGLALLLAAAFPASDATSDVLELTDDNFERRVADTGSAGLMLVEFFAPWC
GHCKRLAPEYEAAATRLKGIVPLAKVDCTANSNTCNKYGVSGYPTLKIFRNGEESGAYDG
PRTADGIVSHLKKQAGPASLPLMSAEDFEKFISDKTASVVGFFGDLLSDSHSEFLKAASN
LRENYRFAHTNVDALVRKYDPDGEGITLFRPPHLANKFEENTVQYTEEKITSGKIKKFIQ
ENIFGICPHMTEDNKDLLQGKDLLVAYYDVDYEMNAKGSNYWRNRVMMVAKKFLEAGQRL
NFAVASRKTFSHELSEFGLERTFGEIPVVAIKTAKGEKYVMQEEFSRDGKALERFLQNYF
DGNLRRYLKSEPIPETNDGPVKIVVAENFDEIVNTDKDVLIEFYAPWCGHCKNLEPKYKE
LGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANSKQNPRKYEGGREVSDFIN
YLQREATNPPVIQEEKSKKKKAEEDL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggccatgcgccgccgcctcgctctgctcccgggtctggcgctgctgctagcagcggcc
ttcccggcctctgacgccacctccgatgtgctggagctcacggacgacaacttcgagcgg
cgcgtggccgatacgggcagtgccggcctgatgctggtggagttcttcgcaccctggtgt
ggacattgtaagaggcttgccccagaatatgaagctgcagcaaccaggttaaaaggaata
gttcctttggcaaaggttgactgtactgctaactcaaatacctgtaataaatatggagtt
agtggctatcccaccctgaaaatatttagaaatggtgaagagtcaggtgcttatgatggc
cctcggacagctgatggaattgtaagtcatctgaagaagcaggcaggacctgcctcactt
cctcttatgagtgcagaagattttgagaagttcattagtgacaaaactgcttctgtggtg
ggtttctttggtgacttactcagtgactctcactcagaattcctaaaagctgcttcaaac
ttgagagaaaactatcgctttgcacatactaatgtcgatgctctggtgaggaagtatgat
cctgatggagagggtatcactttgttccggcctccacatctggctaacaaatttgaggaa
aacactgtacaatacacagaggaaaagataaccagtggcaaaattaaaaaatttatccag
gaaaacatctttggtatttgccctcacatgacggaagacaacaaagatctactccagggc
aaggatctactcgtggcttactatgatgtggattatgaaatgaacgctaagggatccaac
tactggagaaacagagtaatgatggtggcaaagaaattcctggaagctgggcagagactc
aactttgctgtggctagtcgtaaaacttttagccatgaactttctgagtttggcttggaa
agaacctttggagagatacctgttgttgctatcaaaactgcaaaaggagaaaaatatgtt
atgcaagaagagttctcccgtgatgggaaggcccttgagcgattcctgcagaattacttt
gatggcaacctgaggagatacttaaagtctgaacctatcccagagactaatgatggacct
gtgaagattgtggtagctgagaactttgatgaaattgtgaatactgataaagatgttcta
atagaattttatgccccttggtgtggtcactgcaaaaatctggagcccaagtacaaagag
ttgggagaaaagctcagcaaagatcccaatattgtcatagcaaagatggatgcaactgcc
aatgatgtgccttctccatatgaagtcagaggcttccctaccatctacttctctccagcc
aatagtaaacagaatccacggaaatatgaaggtggccgtgaagttagtgactttattaac
tacctacaaagagaagctacaaatcctcctgtgatccaagaggaaaaatccaaaaagaag
aaggcagaggaagatctctaa

DBGET integrated database retrieval system