KEGG   Sarcophilus harrisii (Tasmanian devil): 100921052Help
Entry
100921052         CDS       T02286                                 

Gene name
USP7
Definition
ubiquitin specific peptidase 7 (herpes virus-associated)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
FoxO signaling pathway
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:shr04068]
Human Diseases; Cancers; Viral carcinogenesis [PATH:shr05203]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:shr05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:shr05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1059 aa AA seqDB search
MADGHNNTEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYP
DRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYKDDEKSFSRRISHLFFHKENDWGF
SNFMAWSEVTDPEKGFIEDDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNS
LLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWET
LDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKDVDYRSDRREDY
YDIQLSIKGKKNIFESFIDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLM
RFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVV
YLNPRGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEV
LQAVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVTEDQFCGHQGNDMYDEE
KVKYTVFKVLKNSSLAEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKT
MIELSDNENPWTIFLETVDPEMAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYT
PISCKIRKSLRDLLPVMCERAGFSQETNLILYEEVKPNLTERIQDYDVSLDKALDELMDG
DIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVA
KTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKM
KITDFENRRSFKCIWLNSQFREEEITLYPDKHGCVRDLLEECKKAVELCEKASGKLRLLE
IVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLITVAHFHKEVFGTF
GIPFLLRIHQGEHFREVMKRIQTMLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDF
EAQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKIHN
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atggccgatggacataacaacacagaggaagatatggaggatgataccagctggcgttca
gaagcaacctttcagtttacagttgaacgtttcagcaggctgagtgagtcagtccttagt
cctccatgttttgtacggaatcttccatggaagatcatggtgatgccacgattttatcca
gacagaccacaccaaaaaagcgtaggattctttctccaatgcaatgctgaatctgactcc
acgtcatggtcttgtcatgcacaagctgtgctgaagataataaattacaaagatgatgaa
aaatcattcagccgccgcatcagtcacttattctttcataaagaaaatgattggggattt
tccaatttcatggcatggagtgaagttactgatcctgaaaaaggatttatagaagatgac
aaggttacttttgaagtctatgtacaggcagatgctccccatggagttgcgtgggattcc
aagaagcatacgggatatgttggtttaaagaaccagggagcaacttgttacatgaacagt
ttgttacaaactttatttttcacaaatcaactacgcaaggctgtatacatgatgccaaca
gaaggtgatgactcatcaaaaagtgttcctttagcattacaaagagtgttttatgaatta
caacacagtgacaaaccagtaggaacaaaaaagctaacaaaatcatttggatgggaaact
ttagacagcttcatgcaacatgatgtccaagaactatgtcgagtgttgcttgataatgtg
gagaataaaatgaaaggaacgtgtgtagaaggcaccatacctaaattatttagaggcaag
atggtgtcctatatccagtgcaaagatgtggactatcgatctgatcggagagaagattat
tatgatatccagctaagtataaaggggaaaaagaatatatttgagtccttcatagattat
gtggcagtagaacagctagatggtgacaacaaatatgatgctggagagcatggcttgcag
gaagctgaaaaaggtgtgaaattcctcacattgccaccagtgttacatctacaactcatg
agatttatgtatgacccacagacggaccaaaatatcaagataaatgataggttcgagttt
cctgaacagttaccacttgatgaatttttgcaaaaaactgatcccaaggatcctgcaaat
tatattcttcatgcagtactagtacatagtggagataatcatggtggacattatgtggtt
tacctaaaccctagaggggatggcaaatggtgtaaatttgatgacgatgttgtgtcaagg
tgtacaaaggaagaagcaattgagcataattacggaggtcatgatgatgacttatcagtt
cggcattgtacaaatgcttatatgttagtttatatcagggaatcaaaactgagtgaagtt
ttgcaagctgtcactgatcatgatattcctcaacaattggtagaacgcttacaagaagaa
aaaagaatagaggctcaaaagaggaaggagcgacaggaagcccatctctatatgcaagtg
cagatagtgaccgaggaccagttttgtgggcaccaaggcaatgatatgtatgatgaagaa
aaagtaaaatatacagtcttcaaagtattaaaaaattcctcattagctgagtttgtacag
aatctttctcaaacaatgggatttccgcaggatcagattcgattatggcccatgcaggca
aggagtaatggaacaaaacgaccagcaatgttagataatgaagcagatggcaataaaaca
atgattgaactcagtgacaatgaaaatccatggacgatattccttgaaacagtagatcct
gagatggctgctagtggggcaacattaccgaagtttgacaaagatcatgatgtaatgctg
ttcctgaagatgtatgatcccaaaacacggagtttgaattattgtggacatatctatact
cctatatcctgtaaaattcgtaagtctttacgcgatttgctcccagttatgtgtgaaaga
gcaggattttcccaagaaactaaccttatcctctatgaggaagttaaaccgaatttaaca
gagagaattcaggattatgatgtgtctcttgataaagcactcgatgaactaatggatggt
gacatcatagtgtttcagaaagatgacccagaaaatgataacagtgaactaccaactgca
aaggaatatttcagagacttgtatcaccgtgtggatgtcattttctgtgataaaactatt
cccaatgatcctggatttgttgttactttgtcaaataggatgaattattttcaggttgca
aagacagttgcacagaggctaaatacagatccaatgctacttcagtttttcaagtcccaa
ggttatagggatggcccaggtaatcctcttagacataattatgaaggtactttaagagat
ctcctgcagttctttaaacccagacaacccaagaaactttactaccagcagctgaaaatg
aaaataacagatttcgaaaatcggaggagttttaaatgcatttggctaaacagtcaattt
agggaagaggaaataacactatatccagacaaacatggctgtgtccgggacctgttagaa
gaatgtaaaaaggctgtagaactatgcgagaaagcatcagggaaacttaggctgctagaa
attgtaagctacaaaattattggtgtccatcaggaagatgagttgttagaatgtttatca
cctgcaacaagtcgaacatttcgaatagaggaaatacccttggaccaggtagatatagat
aaagaaaatgagatgctaatcacagtggctcatttccacaaagaggtctttggaactttt
ggtataccatttttgctcaggatacaccagggtgaacatttcagagaagtgatgaaacga
attcagacaatgctagatatccaggaaaaagagtttgagaagtttaaatttgccattgta
atgatgggtcggcaccagtacataaatgaagatgaatatgaagtcaatttgaaagatttt
gaggctcagccgggtaacatgtctcatcccaggccttggctggggcttgaccatttcaat
aaagccccaaagagaagtcgctacacttaccttgaaaaggctattaaaattcataactga

DBGET integrated database retrieval system