KEGG   Sarcophilus harrisii (Tasmanian devil): 100921052Help
Entry
100921052         CDS       T02286                                 

Gene name
USP7
Definition
(RefSeq) ubiquitin specific peptidase 7
  KO
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
FoxO signaling pathway
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100921052 (USP7)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100921052 (USP7)
  Infectious diseases
   05168 Herpes simplex infection
    100921052 (USP7)
   05169 Epstein-Barr virus infection
    100921052 (USP7)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100921052 (USP7)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100921052 (USP7)
Ubiquitin system [BR:shr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100921052 (USP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1055 aa AA seqDB search
MADGHNNTEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYP
DRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYKDDEKSFSRRISHLFFHKENDWGF
SNFMAWSEVTDPEKGFIEDDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNS
LLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWET
LDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKDVDYRSDRREDY
YDIQLSIKGKKNIFESFIDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLM
RFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVV
YLNPRGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEV
LQAVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVTEDQFCGHQGNDMYDEE
KVKYTVFKVLKNSSLAEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKT
MIELSDNENPWTIFLETVDPEMAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYT
PISCKIRDLLPVMCERAGFSQETNLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIV
FQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVA
QRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITD
FENRRSFKCIWLNSQFREEEITLYPDKHGCVRDLLEECKKAVELCEKASGKLRLLEIVSY
KIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLITVAHFHKEVFGTFGIPF
LLRIHQGEHFREVMKRIQTMLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEAQP
GNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKIHN
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atggccgatggacataacaacacagaggaagatatggaggatgataccagctggcgttca
gaagcaacctttcagtttacagttgaacgtttcagcaggctgagtgagtcagtccttagt
cctccatgttttgtacggaatcttccatggaagatcatggtgatgccacgattttatcca
gacagaccacaccaaaaaagcgtaggattctttctccaatgcaatgctgaatctgactcc
acgtcatggtcttgtcatgcacaagctgtgctgaagataataaattacaaagatgatgaa
aaatcattcagccgccgcatcagtcacttattctttcataaagaaaatgattggggattt
tccaatttcatggcatggagtgaagttactgatcctgaaaaaggatttatagaagatgac
aaggttacttttgaagtctatgtacaggcagatgctccccatggagttgcgtgggattcc
aagaagcatacgggatatgttggtttaaagaaccagggagcaacttgttacatgaacagt
ttgttacaaactttatttttcacaaatcaactacgcaaggctgtatacatgatgccaaca
gaaggtgatgactcatcaaaaagtgttcctttagcattacaaagagtgttttatgaatta
caacacagtgacaaaccagtaggaacaaaaaagctaacaaaatcatttggatgggaaact
ttagacagcttcatgcaacatgatgtccaagaactatgtcgagtgttgcttgataatgtg
gagaataaaatgaaaggaacgtgtgtagaaggcaccatacctaaattatttagaggcaag
atggtgtcctatatccagtgcaaagatgtggactatcgatctgatcggagagaagattat
tatgatatccagctaagtataaaggggaaaaagaatatatttgagtccttcatagattat
gtggcagtagaacagctagatggtgacaacaaatatgatgctggagagcatggcttgcag
gaagctgaaaaaggtgtgaaattcctcacattgccaccagtgttacatctacaactcatg
agatttatgtatgacccacagacggaccaaaatatcaagataaatgataggttcgagttt
cctgaacagttaccacttgatgaatttttgcaaaaaactgatcccaaggatcctgcaaat
tatattcttcatgcagtactagtacatagtggagataatcatggtggacattatgtggtt
tacctaaaccctagaggggatggcaaatggtgtaaatttgatgacgatgttgtgtcaagg
tgtacaaaggaagaagcaattgagcataattacggaggtcatgatgatgacttatcagtt
cggcattgtacaaatgcttatatgttagtttatatcagggaatcaaaactgagtgaagtt
ttgcaagctgtcactgatcatgatattcctcaacaattggtagaacgcttacaagaagaa
aaaagaatagaggctcaaaagaggaaggagcgacaggaagcccatctctatatgcaagtg
cagatagtgaccgaggaccagttttgtgggcaccaaggcaatgatatgtatgatgaagaa
aaagtaaaatatacagtcttcaaagtattaaaaaattcctcattagctgagtttgtacag
aatctttctcaaacaatgggatttccgcaggatcagattcgattatggcccatgcaggca
aggagtaatggaacaaaacgaccagcaatgttagataatgaagcagatggcaataaaaca
atgattgaactcagtgacaatgaaaatccatggacgatattccttgaaacagtagatcct
gagatggctgctagtggggcaacattaccgaagtttgacaaagatcatgatgtaatgctg
ttcctgaagatgtatgatcccaaaacacggagtttgaattattgtggacatatctatact
cctatatcctgtaaaattcgcgatttgctcccagttatgtgtgaaagagcaggattttcc
caagaaactaaccttatcctctatgaggaagttaaaccgaatttaacagagagaattcag
gattatgatgtgtctcttgataaagcactcgatgaactaatggatggtgacatcatagtg
tttcagaaagatgacccagaaaatgataacagtgaactaccaactgcaaaggaatatttc
agagacttgtatcaccgtgtggatgtcattttctgtgataaaactattcccaatgatcct
ggatttgttgttactttgtcaaataggatgaattattttcaggttgcaaagacagttgca
cagaggctaaatacagatccaatgctacttcagtttttcaagtcccaaggttatagggat
ggcccaggtaatcctcttagacataattatgaaggtactttaagagatctcctgcagttc
tttaaacccagacaacccaagaaactttactaccagcagctgaaaatgaaaataacagat
ttcgaaaatcggaggagttttaaatgcatttggctaaacagtcaatttagggaagaggaa
ataacactatatccagacaaacatggctgtgtccgggacctgttagaagaatgtaaaaag
gctgtagaactatgcgagaaagcatcagggaaacttaggctgctagaaattgtaagctac
aaaattattggtgtccatcaggaagatgagttgttagaatgtttatcacctgcaacaagt
cgaacatttcgaatagaggaaatacccttggaccaggtagatatagataaagaaaatgag
atgctaatcacagtggctcatttccacaaagaggtctttggaacttttggtataccattt
ttgctcaggatacaccagggtgaacatttcagagaagtgatgaaacgaattcagacaatg
ctagatatccaggaaaaagagtttgagaagtttaaatttgccattgtaatgatgggtcgg
caccagtacataaatgaagatgaatatgaagtcaatttgaaagattttgaggctcagccg
ggtaacatgtctcatcccaggccttggctggggcttgaccatttcaataaagccccaaag
agaagtcgctacacttaccttgaaaaggctattaaaattcataactga

DBGET integrated database retrieval system