KEGG   Sarcophilus harrisii (Tasmanian devil): 100921187Help
Entry
100921187         CDS       T02286                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04024  cAMP signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04110  Cell cycle
shr04310  Wnt signaling pathway
shr04330  Notch signaling pathway
shr04350  TGF-beta signaling pathway
shr04520  Adherens junction
shr04630  Jak-STAT signaling pathway
shr04720  Long-term potentiation
shr04916  Melanogenesis
shr04919  Thyroid hormone signaling pathway
shr04922  Glucagon signaling pathway
shr05016  Huntington's disease
shr05152  Tuberculosis
shr05161  Hepatitis B
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  HTLV-I infection
shr05167  Kaposi's sarcoma-associated herpesvirus infection
shr05168  Herpes simplex infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05206  MicroRNAs in cancer
shr05211  Renal cell carcinoma
shr05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100921187 (EP300)
   04330 Notch signaling pathway
    100921187 (EP300)
   04350 TGF-beta signaling pathway
    100921187 (EP300)
   04630 Jak-STAT signaling pathway
    100921187 (EP300)
   04066 HIF-1 signaling pathway
    100921187 (EP300)
   04068 FoxO signaling pathway
    100921187 (EP300)
   04024 cAMP signaling pathway
    100921187 (EP300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100921187 (EP300)
  Cellular community - eukaryotes
   04520 Adherens junction
    100921187 (EP300)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    100921187 (EP300)
   04919 Thyroid hormone signaling pathway
    100921187 (EP300)
   04916 Melanogenesis
    100921187 (EP300)
  Nervous system
   04720 Long-term potentiation
    100921187 (EP300)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100921187 (EP300)
   05206 MicroRNAs in cancer
    100921187 (EP300)
   05203 Viral carcinogenesis
    100921187 (EP300)
   05211 Renal cell carcinoma
    100921187 (EP300)
   05215 Prostate cancer
    100921187 (EP300)
  Neurodegenerative diseases
   05016 Huntington's disease
    100921187 (EP300)
  Infectious diseases
   05152 Tuberculosis
    100921187 (EP300)
   05166 HTLV-I infection
    100921187 (EP300)
   05164 Influenza A
    100921187 (EP300)
   05161 Hepatitis B
    100921187 (EP300)
   05168 Herpes simplex infection
    100921187 (EP300)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100921187 (EP300)
   05169 Epstein-Barr virus infection
    100921187 (EP300)
   05165 Human papillomavirus infection
    100921187 (EP300)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100921187 (EP300)
Transcription factors [BR:shr03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100921187 (EP300)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100921187 (EP300)
Mitochondrial biogenesis [BR:shr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100921187 (EP300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1 RNase_H2-Ydr279
Motif
Other DBs
NCBI-GeneID: 100921187
NCBI-ProteinID: XP_023361120
Ensembl: ENSSHAG00000006684
Position
5
AA seq 2430 aa AA seqDB search
MAENVVEPGPPAPKRPKLASPALSVAASDGTDFGSLFDLEHDLPDELISSSELGLTNGGD
INQIQSSLSIAQDAASKHKQLSELLRAGSSPNLNMGVGGPGQGMATQAQQNSPGMGILNS
MVKSPMGQAGLTSPNMGVGASGPNQGPSAQSAAGMIPGVNSPVNQPGLGMSTGMGAGMNP
GMLATGNGQGMMPSQVMNGSIGAGRGRPNMPYPNQGMGNTGNLLAEPLQQGSPQMGGQAG
LRGPQPGGSLGKMGIMNNPNPYGPPYSQNPAQQIGAAGLGPQMQNKAGMPNSLPQFPMDK
KPVPGAGMPNMGQQQAPQVQPPGMVPSAPQGMGSGPPTADPEKRKLIQQQLVLLLHAHKC
QRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDC
PVCLPLKNAGDKRNQQSILTGASVGIGNAGSVGVGQQSTPSLNPPSQIDPSSIERAYAAL
GLTYQGNQMQTQPQAPVKNQQPGQPAQGMRPMNALSASPMGVNGGVGVQPSSLLPDAMIH
STMNSQNPMMNENAGVANLGALPAANQPANAGIRKQWHEDITQDLRNHLVHKLVQAIFPT
PDPAALKDRRMENLVAYARKVEGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQK
QNLMPTGPGLAPPSMSQGPSLGPPPPTMAANGPLPDPTMIRANVPTQMMPRMPPQTGMNQ
FGQMNMQLPSLGPRQTPPLQHPGQLSQAGPMNQSLAFASRMQQPGVGQPSSQNQFLQQNQ
FSASSQGLNAANMPMAQPNSQAPVSQAQMSSSSCPVNSPAMAPGSQGNHIHCPPLPQPSL
HRNSPSPVPSRTPTPHHTPPGMGSQQPPAPVASAPAPTPPAMNSGPQPPALHPTPRQTPT
PPQAQLPPQVQPPLPAVPSVEPPQQQPLSQQSATPSVPTPTAPLPPQQPTTPLSQPAVSI
EGQVSNPPSTSSTEVNSQTAPEQQPSQDLKIGSKMEEDPSEPGDPQPEDKPEVKAVAATE
DSKLEAMDTEEKPREVKMEVKEEEEQPNTPATQSSPAPGQSKKKIFKPEELRQALMPTLE
ALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWL
MFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLC
TIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPEL
FVECIECGRKMHQICVLHNEVIWPSGFVCDGCLKKTGRTRKENKFSAKRLPSTRLGTFLE
NRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAF
EEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCFRTAVYHEILIGYLE
YVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKSVSERIVHDY
KDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKG
DSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAG
PAANSLPPIAEPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQ
DRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAA
TQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICK
QLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQ
QQGLPSPTPATPTTPTGQQPPTPQTPQPQPPPQPAAQPQPAPPNNMPPYSMPRAQPPGPV
SQGKAGGQVTPPTPPQTSQPPVQGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHPM
PQMTQMAPMGMNPPPMARGPGGHLEQGLGPAGVQQQPPWAQSGLPQPQQFQPGMQRPAMM
SGNQPGQPMNMAPQPGLGQVPAVAQSKQGSLPQAALQNLLRTLRSPSSPMQQQQVLNILH
ANPQLLAAFIKQRAAKYATQNPQGLPQGQPTMQVQQGVHPNPAMQAMNPMQAGVQRASLP
PPQPQPPPQPQPPPAMGGVSPQAPQMNMNHGGMSAQFRELLMRRQQQQLLDQQRQQQQGV
GPAMGNHGQFPQPQSLGYPQQQQQQRMQHHMQQMQPGAMGQMSQLPQAMGAEPAAQLQQA
YQQRLLQQQMGSPAPPNPMSPQQHMLPGQAQGQQIPPSLSSQVRSPQPVPSPRPQSQPPH
SSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANAMEQGHFASPDQSAMLSQLAGNPGMAG
LHGAGASDLGLSADSSDLNSSLSQSTLDIH
NT seq 7293 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacgtggtggagcccgggccgcccgccccgaagcggcccaagcttgcctca
ccggccctgtctgtggccgccagcgacggcacagattttggatccttgtttgacttagaa
cacgacttaccagatgaattaatcagctcttcagaattgggacttaccaatggtggtgac
attaatcagatccagtcaagtcttagcatagcacaagatgctgcctcaaaacataaacag
ctttctgaattgttacgggctggcagttccccgaatctcaatatgggagttggtggccct
ggacaaggcatggctactcaagcccagcagaacagtcctggaatgggaatattgaatagc
atggtcaaaagccccatgggccaggccggcttgacttctccgaacatgggagtgggtgcc
agtgggccaaatcaaggtccttcagcacagtctgccgcgggtatgatcccaggagtgaac
agtccggttaatcagcctggcctcgggatgagcacaggcatgggtgctggcatgaatcct
ggcatgttagctacaggcaacgggcaggggatgatgccaagtcaagtcatgaacggttcc
attggagcgggcagagggagaccgaacatgccgtatccaaaccaaggcatgggaaacacc
ggcaatttactggctgagccactgcaacaaggctctccccagatgggaggacaagccgga
ttaaggggtccacagcctggaggatccttgggcaagatgggaataatgaacaatcccaat
ccttatggtccaccgtacagtcagaaccctgctcaacagattggagctgctggacttggt
ccccagatgcagaacaaggctggaatgcccaacagcttgccccagtttccaatggacaaa
aagcctgttcctggagcaggaatgcctaacatgggccagcagcaggcccctcaagttcag
ccacctggcatggtgccctctgcaccccagggaatgggttctggaccccccacagctgat
cctgagaagaggaagctcattcaacagcaacttgttcttctcttgcatgcccacaagtgt
cagcggcgcgagcaagccaacggggaagtgcgccagtgtaaccttccccactgtcgcaca
atgaagaatgtcctcaaccacatgacacattgccaggctggcaagtcctgccaggtggca
cattgtgcttcttcaagacaaatcatctcacactggaagaattgcacaaggcacgactgt
cctgtgtgtttgcccctcaaaaatgctggggataaaagaaatcaacaatcaatattgacc
ggcgcttcagtgggcattggaaatgctggttctgtaggggtgggtcagcaaagtactccc
agcctaaaccctcccagtcagattgatcccagctccatagagcgggcgtatgcagctctt
ggcctaacttatcaaggaaaccagatgcagactcagccgcaagctccagtgaagaaccag
cagccagggcagccagcccagggcatgcgccccatgaacgccttgagtgccagtcctatg
ggtgtgaatggaggtgtaggggttcaaccatctagtttgcttcctgacgcaatgatacat
tcaaccatgaattcccaaaacccaatgatgaatgaaaatgctggtgttgccaacctgggg
gctctgccagcagccaaccagccagctaacgctggaatccggaagcagtggcatgaagat
attacccaggatcttcggaatcatcttgttcataaacttgtccaagccatattcccaacc
ccggatcctgctgctctcaaagacaggcggatggagaacctggttgcttacgctcggaaa
gtggagggagacatgtatgaatctgcaaatagtcgggctgagtactatcaccttcttgct
gaaaagatctacaagattcagaaagaactagaggagaaacgccgtactaggctccagaaa
cagaacctgatgcctactggtcccggcctagcgcctccttccatgagtcaggggcccagc
ctggggcccccaccgcccaccatggctgccaatggtcctttgccagacccaaccatgatc
cgtgccaatgttccgacccagatgatgcctcggatgcctccccagacaggaatgaatcag
tttggccagatgaacatgcagctgccctctcttggacccagacagacgcctcctcttcag
caccctggacagctcagccaggcagggcccatgaaccagtctcttgcctttgcttcacgg
atgcaacagccaggagttggtcagccttccagccagaaccaattccttcaacagaatcag
ttttctgcttcctctcaaggactgaatgctgcaaatatgcctatggctcagcccaacagc
caggcaccagtgtctcaagcacagatgtccagttcttcctgtccggtgaattctcctgca
atggctcctggttctcaggggaaccacattcactgcccccctctccctcaaccctcgctg
catcggaattcaccttctccggtccccagtcggactcctacaccacatcatactccccca
ggcatggggtcccagcagcctccagctccagtagcctcagcccctgctccaacaccccca
gcaatgaactctggaccacagccccctgctctccaccctactccaagacagacgcccaca
cctcctcaggcacagcttcctccccaagtacagcctccacttcctgctgttccttcagtt
gagccaccccagcaacaacccctctcccagcagagcgccacaccatcggtgcccacccca
acggccccactacctcctcaacagccaacaactccactttcccagcctgctgtgagcatc
gaaggacaggtatcaaaccccccatcaactagtagcacggaagtgaattcccagaccgct
cctgagcagcaaccttctcaggaccttaagattggctccaaaatggaggaggatccatca
gaacccggagacccccagccagaggataaaccagaggtcaaagcagtggctgctacggaa
gatagtaagctagaagccatggacacagaagagaaacccagagaagtgaagatggaagtg
aaggaggaagaagagcagccaaacactccagccactcagtcttctccagccccaggacag
tcaaagaaaaaaattttcaagccagaagaattacgtcaggcacttatgccaacactggag
gccctttaccgtcaggatccagaatccctacccttccggcaacctgttgacccccagctt
ctaggaatcccggattattttgatatcgtgaagagtccaatggatctctctaccattaaa
aggaaattagacactggacagtaccaagagccctggcagtatgtggatgacatatggctt
atgttcaacaatgcctggctctataaccgaaagacatcgagagtttacaagtactgctcc
aaactggccgaggtctttgagcaggaaattgatcctgtcatgcagagccttggctattgc
tgtggcagaaagttggagttttcaccccaaacactttgttgctatggcaaacagttgtgc
acaatccctcgagatgccacttactacagttaccaaaacaggtatcatttctgtgagaag
tgtttcaatgaaatccagggcgagagcgtatctctgggggatgatccatcccagcctcaa
actacaataaataaggaacagttttccaaaagaaagaatgacacactggatcctgaacta
tttgttgaatgtatagaatgtggccgaaaaatgcaccagatctgtgtccttcacaacgaa
gtcatctggccctctggatttgtctgtgatgggtgcctgaagaaaactggacgaactcgg
aaggaaaacaagttttcagctaaaaggttgccatccaccaggcttggtaccttccttgaa
aaccgagtaaatgacttcctgagacggcagaatcacccggagtcaggagaggtcacagtt
cgggttgttcatgcttcagataaaaccgtcgaggtgaagccgggcatgaaagcaaggttt
gtcgacagtggtgaaatggcagaatccttcccttaccgaacaaaggcccttttcgccttt
gaggaaatagatggtgttgacttgtgcttttttggcatgcatgttcaggagtatggatct
gactgccctccacccaatcagaggagagtatatatatcttacctcgacagtgttcatttt
ttccgtcccaaatgcttcaggactgcagtctatcatgaaatcttaattggctacttagaa
tatgttaagaaattaggatacaccacggggcacatctgggcctgccccccaagtgaaggt
gatgactacatctttcactgccatcctcccgatcagaagatccccaaacccaaacgactg
caagaatggtacaaaaagatgctggacaagtctgtgtctgagcgcattgtgcatgattac
aaggacatttttaaacaagccacagaagatcgtttaacaagtgcaaaggagcttccttat
tttgaaggggatttctggcccaatgtgctggaggaaagcatcaaggagctagagcaggaa
gaagaagagagaaagagagaagagaacacaagcaatgagagcacagatgtgacaaaggga
gacagcaagaatgccaaaaagaagaataataagaaaacaagcaaaaacaaaagcagcctg
agccggggaaacaagaagaagccaggcatgcccaatgtatcgaatgacctctcccagaag
ttgtacgccaccatggagaagcacaaagaggtcttctttgtgattcgcctcattgccggc
cccgccgccaactctctgccccccatcgctgagcccgacccgctcatcccgtgtgacctg
atggacggccgtgacgccttcctcaccctggccagggacaaacacctggagttctcctcc
ctgcgcagggcccagtggtcgaccatgtgcatgctggtagaactgcacacccaaagccaa
gatcgctttgtctacacctgcaacgagtgcaagcaccatgtggagactagatggcactgc
acagtctgcgaggactatgacttgtgcatcacctgctataacactaagaaccacgaccac
aagatggagaagcttggcctgggcctggacgacgagagcaataaccagcaggcggcggca
acccagagcccgggggattcgcgccggttgagcatccagcgctgcatccagtcactggtc
cacgcctgccagtgccgcaatgccaactgctccctgccttcctgccagaagatgaagagg
gtggtccagcacaccaagggctgcaagcgcaagaccaacggcggctgccccatctgcaag
cagctcatcgccctctgctgctaccatgccaagcactgccaggagaacaagtgcccggtg
cccttctgcctcaacatcaagcacaagctccgccagcagcagctgcagcaccgcctgcag
caggcccagatgctgcgccggaggatggccagcatgcagcgcaccggcgtggtgggccaa
caacagggcctgccctcgccaaccccagcaacgcccaccacacccaccggccagcagccc
cccacgccccagacgcctcagcctcagcccccgccccagcccgccgcccagccccagccc
gcgccccccaacaacatgccgccctacagcatgcccagagctcagccgcctgggcctgtg
tcccagggcaaggcagggggccaggtgacccctcccaccccaccgcagacctctcagccc
cccgtccaaggacccccgccagcagccgtggagatggccatgcagatccagagggccgcc
gagacacagcgccagatggctcacgttcagattttccagcggcccatccaacatccgatg
ccgcagatgactcagatggcccccatgggcatgaaccctccccccatggcccgaggtccc
ggtggccacctggagcagggactggggccggcaggggtgcagcaacagcccccctgggcc
cagagtggcttgccccaaccgcagcagttccagccgggcatgcagaggcccgctatgatg
tcggggaaccagcccgggcagcccatgaacatggctccccagccgggcctgggccaagtc
cccgcggtggcccaatccaagcaaggctccctgccgcaggcagccttacagaacctactg
agaactctgcgctcccccagctcacccatgcagcagcagcaggtgctcaacatcctccac
gccaacccccagctgctggccgccttcatcaagcagcgggcggccaagtacgctacccag
aacccccagggcctcccccaaggccagcccaccatgcaggtgcagcagggcgtgcacccc
aacccggccatgcaggccatgaaccccatgcaggccggtgtgcagagggccagcctgccc
ccgccgcagccgcagccgcctccccagccccagcctccgccggccatggggggggtgagc
ccccaggctccgcagatgaacatgaatcacgggggtatgtcagcccagttccgggagctc
ctcatgaggcggcagcagcagcagctgcttgaccagcagcggcagcagcagcagggggtg
ggccctgccatgggcaaccacggccagttcccgcagccccagagcctgggctacccccag
cagcagcagcagcagcgcatgcagcatcacatgcagcagatgcagccgggagccatggga
cagatgagccagcttccacaggccatgggagcggagccagcggcccaactgcagcaggcc
taccagcagcggctgctccagcagcagatgggctccccggcgccgccgaaccccatgagc
ccccagcagcacatgctcccgggccaggcccagggccagcagattcccccatcgctcagc
agccaagtgcgctccccccagcccgtcccgtccccccggccccagtcccagccgccccac
tccagcccctccccccggatgcagcctcagccgtccccacaccacgtgtccccacagacc
agctccccacacccaggactggtggctgcccaggccaacgccatggagcaagggcacttt
gccagcccagaccagagtgccatgctctcccagctggcgggcaaccccggcatggcgggt
ctccacggggcaggcgcctcggacctggggctgagcgccgacagctcagacttgaattca
agcctttcacagagtacactagacatacactag

DBGET integrated database retrieval system