KEGG   Sarcophilus harrisii (Tasmanian devil): 100921242Help
Entry
100921242         CDS       T02286                                 

Gene name
DLAT
Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00010  Glycolysis / Gluconeogenesis
shr00020  Citrate cycle (TCA cycle)
shr00620  Pyruvate metabolism
shr01100  Metabolic pathways
shr01200  Carbon metabolism
Module
shr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100921242 (DLAT)
   00020 Citrate cycle (TCA cycle)
    100921242 (DLAT)
   00620 Pyruvate metabolism
    100921242 (DLAT)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100921242 (DLAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 100921242
NCBI-ProteinID: XP_023355226
Ensembl: ENSSHAG00000012834
Position
3
AA seq 644 aa AA seqDB search
MWRVCARRARCAAPRTGFISPAAAPREAPSGPAPVPAAIPRRARSSHSGIGALQGWGPGS
GSAAAPRARSLLLQLLGTPGRRWYSFPPHQKVPLPSLSPTMQAGTIARWEKKEGEKINEG
DLIAEVETDKATVGFESLEECYLAKIIVPEGTRDVPIGAIICITVEKAEDVDAFKNYTLD
STAAVPPPTSTAPPPASVASPSAQAPGSSYPTHMQVLLPALSPTMTMGTVQRWEKKVGEK
LSEGDLLAEIETDKATIGFEVQEEGYLAKILIPEGTRDVPLGTPLCIIVEKEADIAAFAD
YRPTEVTDIKPQAPPPTPTPMAAVPPTTPPAATVPSATRPAAPPSTKGKIFVSPLAKKLA
AERGIDLAQVKGTGPDGRITKKDIESFVPSKAAPAPPPTVAIPSPPPAVAAVPTGVFTDI
PISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLEVRKELNMTLAGNSKISVNDFIIKA
SALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPSGLITPIVFNAHIKGLESIANDVVS
LATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAVGASENRLVPADNE
KGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFKKYLEKPITMLL
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgagtgtgcgcgcggcgggcccggtgcgcggccccgcggacaggcttcatcagt
ccggccgcagccccgagggaagcccccagcggaccggccccggtccccgccgcgatcccg
aggcgtgcccgttcttcccacagtgggattggggcgctgcagggctggggtcctggctcc
ggctcggcggccgcgccgcgggctcgttcgctgctgctccagctcctggggacgccgggc
cgacggtggtacagtttccctccgcaccagaaggttcctttgccttctctttcccccaca
atgcaggcaggcaccattgcccgctgggagaaaaaagaaggtgaaaagatcaatgagggt
gaccttatagcagaagttgaaacagataaagccactgttggatttgagagcttagaagag
tgctacctggctaagataattgttccagaaggtaccagggacgtcccaattggagcaatc
atctgtatcacagttgaaaaggcagaggatgtggatgcatttaaaaactatacactggat
tccactgcagcggtccctcccccaacctccacagcacctccccctgcttctgtggcttca
ccttctgcccaggctccagggagctcatatcctactcatatgcaggtcctgctacctgcc
ctctctcccaccatgactatgggtacagttcagaggtgggagaagaaggtgggtgagaaa
ttgagtgaaggagacttgctggctgagatagaaactgacaaagccacaataggttttgaa
gtacaagaggaaggatacctggcaaaaattcttatccctgaaggcacaagagatgtccct
ctaggaactcctctttgtattattgtagaaaaggaagcagatattgctgcatttgctgat
tatagaccaaccgaagtaactgatataaaacctcaagcaccaccacccaccccaaccccg
atggctgcagttcctccaactaccccacctgcagccactgtaccttcagccacccgtcca
gctgctcctcctagtacaaaaggaaaaatatttgtgagtcctcttgcaaagaaattggca
gcagagagaggaattgatcttgcacaagtgaaaggaacaggtccagatggcagaatcacc
aagaaagacattgagtcctttgtgccttcaaaggctgctcctgctcctcctccaacagtt
gccatcccctcaccacctccagcagtggcagcagttcctactggagttttcacagatatc
ccaattagcaatattcgtagagttattgcccagcgtttaatgcaatccaaacaaacaata
cctcattattatctctctattgatgtaaacatgggtgaagttttagaagtacggaaagaa
ctcaacatgacattggcaggaaacagtaagatttctgtcaatgacttcatcattaaagct
tcagctttggcctgtttgaaagtacctgaagctaattcttcttggatggacacagttata
aggcaaaatcatgttgttgatgttagtgttgcagtcagtactccttctggactcatcaca
cccattgtatttaatgcacatataaaaggactagaatccattgctaatgatgtagtttct
ttagcaaccaaagcacgagagggtaaacttcagccacatgaattccagggtggtactttt
accatctctaatttaggtatgtttgggattaagaatttctctgccattattaacccacct
caggcatgtattttggcagttggtgcttcagagaataggctggttccagcagataatgaa
aaaggatttgatgtagccagcatgatgtctgttactctcagctgtgatcatcgggtagtg
gatggagcagttggagctcagtggcttgctgagttcaaaaaataccttgaaaagcctatc
acaatgttgttataa

DBGET integrated database retrieval system