KEGG   Sarcophilus harrisii (Tasmanian devil): 100921242Help
Entry
100921242         CDS       T02286                                 

Gene name
DLAT
Definition
dihydrolipoamide S-acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100921242 (DLAT)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100921242 (DLAT)
   00020 Citrate cycle (TCA cycle)
    100921242 (DLAT)
   00620 Pyruvate metabolism
    100921242 (DLAT)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100921242 (DLAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 600 aa AA seqDB search
MPSTTRPLRDSVPQAPPQKGDHANALQSQNVSPGRLRRGSGRECLFSFQVPLPSLSPTMQ
AGTIARWEKKEGEKINEGDLIAEVETDKATVGFESLEECYLAKIIVPEGTRDVPIGAIIC
ITVEKAEDVDAFKNYTLDSTAAVPPPTSTAPPPASVASPSAQAPGSSYPTHMQVLLPALS
PTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILIPEGTRDVPLG
TPLCIIVEKEADIAAFADYRPTEVTDIKPQAPPPTPTPMAAVPPTTPPAATVPSATRPAA
PPSTKGKIFVSPLAKKLAAERGIDLAQVKGTGPDGRITKKDIESFVPSKAAPPPTVAIPS
PPPAVAAVPTGVFTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLEVRKELNMT
LAGNSKISVNDFIIKASALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPSGLITPIVF
NAHIKGLESIANDVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACI
LAVGASENRLVPADNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFKKYLEKPITMLL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcaccacccgcccgctcagggattccgtcccgcaggctccgccgcagaaaggt
gaccacgcgaatgcacttcagagccagaatgtttccccagggcgcctgcgtagggggagt
gggcgagagtgtctcttttctttccaggttcctttgccttctctttcccccacaatgcag
gcaggcaccattgcccgctgggagaaaaaagaaggtgaaaagatcaatgagggtgacctt
atagcagaagttgaaacagataaagccactgttggatttgagagcttagaagagtgctac
ctggctaagataattgttccagaaggtaccagggacgtcccaattggagcaatcatctgt
atcacagttgaaaaggcagaggatgtggatgcatttaaaaactatacactggattccact
gcagcggtccctcccccaacctccacagcacctccccctgcttctgtggcttcaccttct
gcccaggctccagggagctcatatcctactcatatgcaggtcctgctacctgccctctct
cccaccatgactatgggtacagttcagaggtgggagaagaaggtgggtgagaaattgagt
gaaggagacttgctggctgagatagaaactgacaaagccacaataggttttgaagtacaa
gaggaaggatacctggcaaaaattcttatccctgaaggcacaagagatgtccctctagga
actcctctttgtattattgtagaaaaggaagcagatattgctgcatttgctgattataga
ccaaccgaagtaactgatataaaacctcaagcaccaccacccaccccaaccccgatggct
gcagttcctccaactaccccacctgcagccactgtaccttcagccacccgtccagctgct
cctcctagtacaaaaggaaaaatatttgtgagtcctcttgcaaagaaattggcagcagag
agaggaattgatcttgcacaagtgaaaggaacaggtccagatggcagaatcaccaagaaa
gacattgagtcctttgtgccttcaaaggctgctcctcctccaacagttgccatcccctca
ccacctccagcagtggcagcagttcctactggagttttcacagatatcccaattagcaat
attcgtagagttattgcccagcgtttaatgcaatccaaacaaacaatacctcattattat
ctctctattgatgtaaacatgggtgaagttttagaagtacggaaagaactcaacatgaca
ttggcaggaaacagtaagatttctgtcaatgacttcatcattaaagcttcagctttggcc
tgtttgaaagtacctgaagctaattcttcttggatggacacagttataaggcaaaatcat
gttgttgatgttagtgttgcagtcagtactccttctggactcatcacacccattgtattt
aatgcacatataaaaggactagaatccattgctaatgatgtagtttctttagcaaccaaa
gcacgagagggtaaacttcagccacatgaattccagggtggtacttttaccatctctaat
ttaggtatgtttgggattaagaatttctctgccattattaacccacctcaggcatgtatt
ttggcagttggtgcttcagagaataggctggttccagcagataatgaaaaaggatttgat
gtagccagcatgatgtctgttactctcagctgtgatcatcgggtagtggatggagcagtt
ggagctcagtggcttgctgagttcaaaaaataccttgaaaagcctatcacaatgttgtta
taa

DBGET integrated database retrieval system