KEGG   Sarcophilus harrisii (Tasmanian devil): 100921255Help
Entry
100921255         CDS       T02286                                 

Gene name
LAMC1
Definition
laminin, gamma 1 (formerly LAMB2)
Orthology
K05635  
laminin, gamma 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Prion diseases
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:shr04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:shr04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:shr04510]
Human Diseases; Cancers; Pathways in cancer [PATH:shr05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:shr05222]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:shr05020]
Human Diseases; Infectious diseases; Amoebiasis [PATH:shr05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:shr05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 1535 aa AA seqDB search
AFNVTVVATNTCGAPPEEYCVQTGVTGVTKSCHLCDAGQPHLAHGAAYLTDYNNQADTTW
WQSQTMLAGVRYPSTITLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTQEDGPWIPYQY
YSGSCENTYLKPNRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNS
PVLQEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVK
KDFDKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCNCNGRSQECYFDPEL
YRSTGHGGHCTNCQDNTDGANCERCRENFYRLGNEEACLPCHCSPVGSLSTQCDNYGRCS
CKPGVMGDKCDQCQPGFHSLTEAGCRPCSCNPAGSTDECNVETGRCVCKDNVEGFSCERC
KPGFFHLESSNPRGCTPCFCFGHSSVCTNAEGYSVHSITSTFQIDKEGWRAEERDGSETS
LQWSSESQEISVISESYFPIYFIAPDKFLGNHLLSYGQNLTFSFRVERRDTRLSAEDLVL
EGAGLRVSVPLIAQGNSYPSETTVKYIFRLHEATDYPWRPTLTPFEFQKLLNNLTSIKIR
GTYSERSAGYLDDVTLASAQRGPGVPAVWVESCTCPVGYGGQFCQLCVSGYKRETPSLGP
YSPCVLCTCNGHSETCDPETGVCNCRDNTAGPHCEKCVDGYYGDSTAGTSSDCQPCPCPG
GSSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGENGPTRLCRLCQCSDNIDPN
AVGNCNRLTGECLKCIYNTAGFYCDRCRDGFFGNPLAPNPADKCKACSCNPYGTVNQQTT
CNQVTGQCECLPHVTERDCSICDPGFYNLQSGQGCERCNCHALGSTNGQCDIRTGQCECQ
PGITGQRCEQCEPNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECKEGFVGNRCDQCEE
NYFYNRSWPGCQECPACYRLVKDKVAEHRVKLQELENIIANLGTGDETVTDQAFEDRLKA
AERDVMDLLREAQDIKDIDQNLMDRLQRVNNTLSSQISRLQNIRNTVEETGNLAEQARTR
VESTERLIEIASRELEKAKVAIANVSITQPDSIGDPNNMTLLAEEARKLAERHKKEADDI
VRVAKTANDTSTEAYNLLLRTLAGENQTANEIEELNKKYEQAKNLSRDLEKQATRVHEEA
KRAGDKAVEIYASVAQLTPVDSVALENEANKIKKEAEALDQMMDKKLSDYEDLREDMKGK
ELEVKDLLEKGKAEQQVSPGATRSSTLPERARALASKHPPFALVGPSATPSPRSAGIASP
PGLVREGRERTHAAPFRSCARLAPRDSARPGAVLVSALALAGPANATSTKAEAERTFADV
TNLDKEVDDMLKQLQEAEKELKKKQDDADQDMMMAGMASQAAQEAEINARKAKNSVSSLL
TIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVTDLENEAKKQEAAIVD
YNRDIEEIMKDIRNLEDIKRSLPSGCFNTPSIEKP
NT seq 4610 nt NT seq  +upstreamnt  +downstreamnt
ccgccttcaacgtgaccgtggtggccaccaacacgtgcggcgctccgcccgaggagtact
gcgtgcagaccggggtgacgggggtcaccaagtcctgtcacctgtgcgacgccgggcagc
cccacctggcgcacggggccgcctacctgaccgactacaacaaccaggccgacaccacct
ggtggcagagccagaccatgctggccggggtgcggtatcccagcaccatcaccctcaccc
tgcacctgggaaaagcctttgacatcacatatgtgcgcctgaagtttcataccagtcgcc
ctgagagctttgctatctacaaacggactcaggaagatgggccctggattccataccagt
actacagtggttcctgtgagaatacctacttgaagcccaaccgtggtttcatcaggacag
gaggagatgaacagcaagcattgtgcactgatgaattcagtgacatttctcctctcactg
gaggcaatgtggccttttcaacactggaaggaaggcccagtgcctacaactttgacaata
gccctgtgttgcaggaatgggtaactgccacagacattagagtaactctcaatcgcctaa
atacttttggagatgaagtatttaatgaccccaaagttttgaagtcttattattatgcaa
tttctgattttgcagtgggtggcaggtgtaaatgcaatggacatgcaagtgagtgtgtga
agaaggactttgataagttggtatgtaattgcaaacacaacacttatggagtagattgtg
aaaagtgtcttccattctttaatgaccggccatggaggagagcaactgcagagagtgcca
gcgaatgtttgccttgtaactgcaatggaagatcacaagaatgttactttgaccctgaac
tgtatcgttctacgggccatggtggccactgtaccaactgtcaggataatactgatggtg
ccaattgtgaaagatgtcgggagaatttctatcgccttggaaatgaggaagcatgcctgc
catgccattgtagccctgttggctctctcagtacacagtgtgataattatggacgatgta
gctgtaagccaggtgtgatgggtgacaaatgtgatcagtgccagcctggattccactctc
ttactgaggcaggatgcaggccatgttcttgcaaccctgctggaagtacagatgaatgta
atgttgaaactgggcgttgtgtttgtaaagacaatgtggaaggattcagttgtgagaggt
gcaaacctggattttttcacttggagtcatctaatcctcgaggctgtaccccttgctttt
gttttgggcattcttctgtctgcacgaatgctgaaggatacagtgtccactctatcactt
ccactttccagatagataaggaaggatggcgtgctgaagagcgggacggctctgagacat
cactccagtggtcttctgagagccaggagatctctgtgatctcagagagctactttccca
tatacttcattgctcctgacaagtttttaggtaaccacctgttgagttatggtcagaatc
tcactttctcctttcgagtggaaaggcgggatacacgactctctgcagaagatctggtcc
ttgaaggagctggtcttagagtatctgttcctttaattgctcagggcaactcctatccta
gtgaaaccactgtgaaatacatttttagacttcacgaagcaacagattatccctggagac
ctacccttactccttttgaatttcaaaaactattaaataatttaacttctatcaagattc
gtgggacatacagtgagagaagtgctggatatttggatgatgtcactttggcaagtgctc
agcgtggacctggggtccctgcagtttgggtagagtcctgtacctgccctgtgggatatg
gagggcagttttgtcaactgtgtgtctcaggatacaaaagggaaacacctagtcttggac
cttacagtccttgtgtgctttgtacttgcaatggacatagtgagacctgtgatcctgaga
caggtgtttgtaactgcagagataacacggctggtccacactgtgaaaagtgtgttgatg
gctactatggagattcaacagctggtacttcctctgattgtcaaccttgtccatgcccag
gaggctcaagttgtgccgttgttcccaagacaaaggaggtggtatgcaccaattgtccca
ctggcaccactggtaaaagatgtgaactttgtgatgatggctactttggagatccacttg
gcgaaaatggccccacaagactttgccgactttgtcaatgtagtgacaacattgatccca
atgcggttgggaattgtaacagattaactggagagtgcttaaaatgcatctataacactg
ctggcttttattgtgaccgctgcagagatgggttttttgggaatcccctggcccccaatc
cagcagacaagtgtaaagcttgtagttgtaatccttatggtactgtgaatcaacagacta
cttgtaatcaagtaactggacagtgtgaatgcctccctcacgttactgagagggattgca
gtatctgtgatcctggattctataatctacagagtggacaaggatgtgagagatgtaact
gtcatgctctcggttccaccaatggccagtgtgacatacgcactggacaatgtgaatgtc
agccgggcatcactggccagcgctgtgagcagtgcgagcccaaccactttggctttggac
ctgagggctgcaaaccatgtgactgtcaccctgaggggtcactttcactccagtgcaaag
atgatggtcgttgtgaatgcaaggaaggttttgtgggaaatcgctgtgaccagtgtgaag
aaaattatttctataatcggtcttggcctggctgtcaagagtgtcctgcatgttatagac
tagtgaaagataaagttgctgagcatcgagtgaagctccaggagttagagaacattatag
caaaccttggaactggagatgaaacagttacagatcaagcttttgaggacagactgaagg
cagctgagagagatgttatggacctactacgtgaggcccaggacatcaaagatatagacc
agaacctgatggatcgcctccagagggtcaataataccctgtccagtcaaatcagtcgct
tgcagaatatccgtaacactgtggaagaaaccggaaatttagctgagcaagcccgcactc
gagttgagagcacagaaagacttattgaaatcgcttccagagaactggagaaagcaaaag
tggccattgccaacgtgtcaattacccaaccagattctattggcgatcctaacaacatga
ctctgttggcagaagaagctcgtaaacttgctgaacgacataaaaaagaagctgatgaca
ttgtacgggtagccaagacagccaatgatacatcaactgaagcctataatctactcctaa
ggactttggctggagagaatcaaacagcaaatgaaattgaagaacttaataagaaatatg
aacaagcgaaaaacctctcacgagatctagagaaacaggctacccgagtacatgaagaag
caaaacgagctggagacaaagctgttgagatttatgctagtgttgcccagctgacacctg
tggattctgtggctcttgagaatgaggctaataagataaagaaggaagcagaggccctgg
accaaatgatggacaaaaagctgagcgactacgaggacctccgggaggacatgaaaggca
aggagcttgaagtgaaggacctcctggaaaagggaaaggcggagcagcaggtgagccccg
gggccacacggtcttctactttgccggaacgagcccgtgcccttgcttctaaacatccgc
cctttgccctcgtgggcccgagcgcgacccccagcccccgctctgccgggatagcgtctc
ccccgggcttggtgcgggaaggaagggagagaacgcacgcggcgcctttccgaagttgtg
cgcgcctcgctccacgagatagcgcccggccaggtgccgttttagtgagcgccctggccc
tggctgggcccgcgaatgctaccagtaccaaagcagaggcagaaagaacttttgcagatg
ttacaaatttggataaagaggtggatgacatgctgaaacagttacaagaagcagaaaagg
aactaaagaaaaagcaagatgacgctgatcaggatatgatgatggcaggaatggcttcac
aggctgctcaagaagcagagattaatgcaagaaaggccaagaactctgttagtagccttc
tcaccatcatcaatgacctcttggaacaactcggacaactggacactgtggacctgaaca
agctcaatgagatcgaaggcaccctgaacaaagccaaagatgagatgaaggtcagtgatc
tcgacagaaaagtaaccgatctggagaatgaagccaagaaacaggaggctgccattgtgg
actacaacagagatattgaggaaatcatgaaagacattcgcaacctcgaagatatcaaga
ggagcttgccctcaggctgcttcaacaccccctccattgagaaaccctaa

DBGET integrated database retrieval system