KEGG   Sarcophilus harrisii (Tasmanian devil): 100921255Help
Entry
100921255         CDS       T02286                                 

Gene name
LAMC1
Definition
(RefSeq) laminin subunit gamma-1
  KO
K05635  laminin, gamma 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr05020  Prion diseases
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100921255 (LAMC1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100921255 (LAMC1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100921255 (LAMC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100921255 (LAMC1)
   05222 Small cell lung cancer
    100921255 (LAMC1)
  Neurodegenerative diseases
   05020 Prion diseases
    100921255 (LAMC1)
  Infectious diseases
   05165 Human papillomavirus infection
    100921255 (LAMC1)
   05146 Amoebiasis
    100921255 (LAMC1)
   05145 Toxoplasmosis
    100921255 (LAMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Motif
Other DBs
NCBI-GeneID: 100921255
NCBI-ProteinID: XP_023357584
Ensembl: ENSSHAG00000010160
Position
4
AA seq 1470 aa AA seqDB search
MVNHTCALGLSIWQFHGRKAFDITYVRLKFHTSRPESFAIYKRTQEDGPWIPYQYYSGSC
ENTYLKPNRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKKDFDK
LVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCNCNGRSQECYFDPELYRSTG
HGGHCTNCQDNTDGANCERCRENFYRLGNEEACLPCHCSPVGSLSTQCDNYGRCSCKPGV
MGDKCDQCQPGFHSLTEAGCRPCSCNPAGSTDECNVETGRCVCKDNVEGFSCERCKPGFF
HLESSNPRGCTPCFCFGHSSVCTNAEGYSVHSITSTFQIDKEGWRAEERDGSETSLQWSS
ESQEISVISESYFPIYFIAPDKFLGNHLLSYGQNLTFSFRVERRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTVKYIFRLHEATDYPWRPTLTPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLASAQRGPGVPAVWVESCTCPVGYGGQFCQLCVSGYKRETPSLGPYSPCV
LCTCNGHSETCDPETGVCNCRDNTAGPHCEKCVDGYYGDSTAGTSSDCQPCPCPGGSSCA
VVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGENGPTRLCRLCQCSDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCRDGFFGNPLAPNPADKCKACSCNPYGTVNQQTTCNQVT
GQCECLPHVTERDCSICDPGFYNLQSGQGCERCNCHALGSTNGQCDIRTGQCECQPGITG
QRCEQCEPNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECKEGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVAEHRVKLQELENIIANLGTGDETVTDQAFEDRLKAAERDV
MDLLREAQDIKDIDQNLMDRLQRVNNTLSSQISRLQNIRNTVEETGNLAEQARTRVESTE
RLIEIASRELEKAKVAIANVSITQPDSIGDPNNMTLLAEEARKLAERHKKEADDIVRVAK
TANDTSTEAYNLLLRTLAGENQTANEIEELNKKYEQAKNLSRDLEKQATRVHEEAKRAGD
KAVEIYASVAQLTPVDSVALENEANKIKKEAEALDQMMDKKLSDYEDLREDMKGKELEVK
DLLEKGKAEQQVSPGATRSSTLPERARALASKHPPFALVGPSATPSPRSAGIASPPGLVR
EGRERTHAAPFRSCARLAPRDSARPGAVLVSALALAGPANATSTKAEAERTFADVTNLDK
EVDDMLKQLQEAEKELKKKQDDADQDMMMAGMASQAAQEAEINARKAKNSVSSLLTIIND
LLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVTDLENEAKKQEAAIVDYNRDI
EEIMKDIRNLEDIKRSLPSGCFNTPSIEKP
NT seq 4413 nt NT seq  +upstreamnt  +downstreamnt
atggttaaccacacttgtgctttaggactatcaatttggcaattccacggaagaaaagcc
tttgacatcacatatgtgcgcctgaagtttcataccagtcgccctgagagctttgctatc
tacaaacggactcaggaagatgggccctggattccataccagtactacagtggttcctgt
gagaatacctacttgaagcccaaccgtggtttcatcaggacaggaggagatgaacagcaa
gcattgtgcactgatgaattcagtgacatttctcctctcactggaggcaatgtggccttt
tcaacactggaaggaaggcccagtgcctacaactttgacaatagccctgtgttgcaggaa
tgggtaactgccacagacattagagtaactctcaatcgcctaaatacttttggagatgaa
gtatttaatgaccccaaagttttgaagtcttattattatgcaatttctgattttgcagtg
ggtggcaggtgtaaatgcaatggacatgcaagtgagtgtgtgaagaaggactttgataag
ttggtatgtaattgcaaacacaacacttatggagtagattgtgaaaagtgtcttccattc
tttaatgaccggccatggaggagagcaactgcagagagtgccagcgaatgtttgccttgt
aactgcaatggaagatcacaagaatgttactttgaccctgaactgtatcgttctacgggc
catggtggccactgtaccaactgtcaggataatactgatggtgccaattgtgaaagatgt
cgggagaatttctatcgccttggaaatgaggaagcatgcctgccatgccattgtagccct
gttggctctctcagtacacagtgtgataattatggacgatgtagctgtaagccaggtgtg
atgggtgacaaatgtgatcagtgccagcctggattccactctcttactgaggcaggatgc
aggccatgttcttgcaaccctgctggaagtacagatgaatgtaatgttgaaactgggcgt
tgtgtttgtaaagacaatgtggaaggattcagttgtgagaggtgcaaacctggatttttt
cacttggagtcatctaatcctcgaggctgtaccccttgcttttgttttgggcattcttct
gtctgcacgaatgctgaaggatacagtgtccactctatcacttccactttccagatagat
aaggaaggatggcgtgctgaagagcgggacggctctgagacatcactccagtggtcttct
gagagccaggagatctctgtgatctcagagagctactttcccatatacttcattgctcct
gacaagtttttaggtaaccacctgttgagttatggtcagaatctcactttctcctttcga
gtggaaaggcgggatacacgactctctgcagaagatctggtccttgaaggagctggtctt
agagtatctgttcctttaattgctcagggcaactcctatcctagtgaaaccactgtgaaa
tacatttttagacttcacgaagcaacagattatccctggagacctacccttactcctttt
gaatttcaaaaactattaaataatttaacttctatcaagattcgtgggacatacagtgag
agaagtgctggatatttggatgatgtcactttggcaagtgctcagcgtggacctggggtc
cctgcagtttgggtagagtcctgtacctgccctgtgggatatggagggcagttttgtcaa
ctgtgtgtctcaggatacaaaagggaaacacctagtcttggaccttacagtccttgtgtg
ctttgtacttgcaatggacatagtgagacctgtgatcctgagacaggtgtttgtaactgc
agagataacacggctggtccacactgtgaaaagtgtgttgatggctactatggagattca
acagctggtacttcctctgattgtcaaccttgtccatgcccaggaggctcaagttgtgcc
gttgttcccaagacaaaggaggtggtatgcaccaattgtcccactggcaccactggtaaa
agatgtgaactttgtgatgatggctactttggagatccacttggcgaaaatggccccaca
agactttgccgactttgtcaatgtagtgacaacattgatcccaatgcggttgggaattgt
aacagattaactggagagtgcttaaaatgcatctataacactgctggcttttattgtgac
cgctgcagagatgggttttttgggaatcccctggcccccaatccagcagacaagtgtaaa
gcttgtagttgtaatccttatggtactgtgaatcaacagactacttgtaatcaagtaact
ggacagtgtgaatgcctccctcacgttactgagagggattgcagtatctgtgatcctgga
ttctataatctacagagtggacaaggatgtgagagatgtaactgtcatgctctcggttcc
accaatggccagtgtgacatacgcactggacaatgtgaatgtcagccgggcatcactggc
cagcgctgtgagcagtgcgagcccaaccactttggctttggacctgagggctgcaaacca
tgtgactgtcaccctgaggggtcactttcactccagtgcaaagatgatggtcgttgtgaa
tgcaaggaaggttttgtgggaaatcgctgtgaccagtgtgaagaaaattatttctataat
cggtcttggcctggctgtcaagagtgtcctgcatgttatagactagtgaaagataaagtt
gctgagcatcgagtgaagctccaggagttagagaacattatagcaaaccttggaactgga
gatgaaacagttacagatcaagcttttgaggacagactgaaggcagctgagagagatgtt
atggacctactacgtgaggcccaggacatcaaagatatagaccagaacctgatggatcgc
ctccagagggtcaataataccctgtccagtcaaatcagtcgcttgcagaatatccgtaac
actgtggaagaaaccggaaatttagctgagcaagcccgcactcgagttgagagcacagaa
agacttattgaaatcgcttccagagaactggagaaagcaaaagtggccattgccaacgtg
tcaattacccaaccagattctattggcgatcctaacaacatgactctgttggcagaagaa
gctcgtaaacttgctgaacgacataaaaaagaagctgatgacattgtacgggtagccaag
acagccaatgatacatcaactgaagcctataatctactcctaaggactttggctggagag
aatcaaacagcaaatgaaattgaagaacttaataagaaatatgaacaagcgaaaaacctc
tcacgagatctagagaaacaggctacccgagtacatgaagaagcaaaacgagctggagac
aaagctgttgagatttatgctagtgttgcccagctgacacctgtggattctgtggctctt
gagaatgaggctaataagataaagaaggaagcagaggccctggaccaaatgatggacaaa
aagctgagcgactacgaggacctccgggaggacatgaaaggcaaggagcttgaagtgaag
gacctcctggaaaagggaaaggcggagcagcaggtgagccccggggccacacggtcttct
actttgccggaacgagcccgtgcccttgcttctaaacatccgccctttgccctcgtgggc
ccgagcgcgacccccagcccccgctctgccgggatagcgtctcccccgggcttggtgcgg
gaaggaagggagagaacgcacgcggcgcctttccgaagttgtgcgcgcctcgctccacga
gatagcgcccggccaggtgccgttttagtgagcgccctggccctggctgggcccgcgaat
gctaccagtaccaaagcagaggcagaaagaacttttgcagatgttacaaatttggataaa
gaggtggatgacatgctgaaacagttacaagaagcagaaaaggaactaaagaaaaagcaa
gatgacgctgatcaggatatgatgatggcaggaatggcttcacaggctgctcaagaagca
gagattaatgcaagaaaggccaagaactctgttagtagccttctcaccatcatcaatgac
ctcttggaacaactcggacaactggacactgtggacctgaacaagctcaatgagatcgaa
ggcaccctgaacaaagccaaagatgagatgaaggtcagtgatctcgacagaaaagtaacc
gatctggagaatgaagccaagaaacaggaggctgccattgtggactacaacagagatatt
gaggaaatcatgaaagacattcgcaacctcgaagatatcaagaggagcttgccctcaggc
tgcttcaacaccccctccattgagaaaccctaa

DBGET integrated database retrieval system