KEGG   Sarcophilus harrisii (Tasmanian devil): 100921262Help
Entry
100921262         CDS       T02286                                 

Gene name
P4HB
Definition
prolyl 4-hydroxylase, beta polypeptide
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:shr04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 510 aa AA seqDB search
MLSRALLCLALAVTAGVRADSPEEEDDVLVLKKSNFEKALATYEYLLVEFYAPWCGHCKA
LAPEYAKAAGKLKAEGSKIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTA
GREAEDIVNWLKKRTSPAVTVLTDVAAAESLVDSNEVAVIGLFKDLESELVKQFTLAAES
IDDIPFGVSSNSDVYSKYQFDKDGIILLKKFDEGRNNFEGEITKENLLTFVNYHRLPLVI
EFTEQTAPKIFGGEIKTHILLFLPKSVSDYDDKLNNFKKAAESFKGKILFIFIDSDHTDN
QRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKIKEFCDRFLEGKVKPHLMSQ
DLPDDWDKQPVKVLVGKNFEEIAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHE
SIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLEGFKKFLESGGLDGA
GDDDDLEDLEEAEEPDMEEDDDQVAPKDEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgctgagccgtgccctgctctgtctagcactggccgtcacggccggggtccgcgctgat
tcccctgaggaggaggatgatgtcctggtcttgaagaagagcaacttcgagaaggcgctg
gcgacctacgagtacctcttggtggagttctatgctccttggtgtggccactgtaaagcc
ctagcacctgagtatgctaaagcagcaggaaaacttaaggctgaaggttctaaaatcaga
ttggccaaagtagatgccactgaagagtctgatctagcacagcagtatggtgttcggggt
taccctaccatcaaattctttaagaatggagatacagcttctcctaaagagtatacagct
ggtagagaagctgaagacattgtgaactggctgaagaaacgcactagtccagcggtcact
gtcctgacagatgttgctgctgctgaatccttggtggattccaatgaagttgctgttatt
ggcttattcaaggacttagagtcagaacttgtcaaacagttcacattggctgcagagtcc
attgatgatatcccatttggagtctcttccaacagtgatgtgtactccaaataccaattt
gataaagatggcattatcctcttgaagaagtttgatgaaggtcgaaacaattttgaagga
gagattaccaaggagaacctattgacttttgttaattatcaccggctgcccttggtcatc
gagttcactgagcagacggcccccaaaatttttggaggtgaaatcaagactcatatcctg
ctgttcctgccaaagagtgtttctgactatgatgacaaactgaataacttcaaaaaagca
gcagaaagcttcaaggggaagatcctgtttatcttcattgatagtgatcacactgacaac
cagaggatccttgaattctttggcctaaagaaagaggaatgtccagctgtccgccttatc
actttggaagaagagatgaccaagtacaagccagagtcggatgaattaactgcagaaaag
ataaaagaattctgtgaccgatttttggagggcaaagttaagcctcatttaatgagccag
gacctacctgatgactgggacaagcaacctgttaaagtactagttgggaagaactttgag
gaaattgcttttgatgaaaaaaagaacgtctttgtagaattctatgctccctggtgtggt
cactgcaaacagttggctcctatttgggacaaattgggagagacttataaggaccatgaa
agtatagtcatcgccaagatggactcaacagctaatgaagtagaggcagttaaggtccac
agtttccccacgttaaagttcttccctgcaagtgctgatagaacggtaattgactacaat
ggagagagaacactagaaggtttcaagaagttcctagagagtggtggattagatggggca
ggggatgatgatgatctagaagacttggaagaagctgaagagccagatatggaagaagat
gatgatcaagtagctccaaaagatgaattgtaa

DBGET integrated database retrieval system