KEGG   Sarcophilus harrisii (Tasmanian devil): 100921262Help
Entry
100921262         CDS       T02286                                 

Gene name
P4HB
Definition
prolyl 4-hydroxylase, beta polypeptide
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100921262 (P4HB)
Enzymes [BR:shr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100921262 (P4HB)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100921262 (P4HB)
  Exosomal proteins of colorectal cancer cells
   100921262 (P4HB)
  Exosomal proteins of bladder cancer cells
   100921262 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 510 aa AA seqDB search
MLSRALLCLALAVTAGVRADSPEEEDDVLVLKKSNFEKALATYEYLLVEFYAPWCGHCKA
LAPEYAKAAGKLKAEGSKIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTA
GREAEDIVNWLKKRTSPAVTVLTDVAAAESLVDSNEVAVIGLFKDLESELVKQFTLAAES
IDDIPFGVSSNSDVYSKYQFDKDGIILLKKFDEGRNNFEGEITKENLLTFVNYHRLPLVI
EFTEQTAPKIFGGEIKTHILLFLPKSVSDYDDKLNNFKKAAESFKGKILFIFIDSDHTDN
QRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKIKEFCDRFLEGKVKPHLMSQ
DLPDDWDKQPVKVLVGKNFEEIAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHE
SIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLEGFKKFLESGGLDGA
GDDDDLEDLEEAEEPDMEEDDDQVAPKDEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgctgagccgtgccctgctctgtctagcactggccgtcacggccggggtccgcgctgat
tcccctgaggaggaggatgatgtcctggtcttgaagaagagcaacttcgagaaggcgctg
gcgacctacgagtacctcttggtggagttctatgctccttggtgtggccactgtaaagcc
ctagcacctgagtatgctaaagcagcaggaaaacttaaggctgaaggttctaaaatcaga
ttggccaaagtagatgccactgaagagtctgatctagcacagcagtatggtgttcggggt
taccctaccatcaaattctttaagaatggagatacagcttctcctaaagagtatacagct
ggtagagaagctgaagacattgtgaactggctgaagaaacgcactagtccagcggtcact
gtcctgacagatgttgctgctgctgaatccttggtggattccaatgaagttgctgttatt
ggcttattcaaggacttagagtcagaacttgtcaaacagttcacattggctgcagagtcc
attgatgatatcccatttggagtctcttccaacagtgatgtgtactccaaataccaattt
gataaagatggcattatcctcttgaagaagtttgatgaaggtcgaaacaattttgaagga
gagattaccaaggagaacctattgacttttgttaattatcaccggctgcccttggtcatc
gagttcactgagcagacggcccccaaaatttttggaggtgaaatcaagactcatatcctg
ctgttcctgccaaagagtgtttctgactatgatgacaaactgaataacttcaaaaaagca
gcagaaagcttcaaggggaagatcctgtttatcttcattgatagtgatcacactgacaac
cagaggatccttgaattctttggcctaaagaaagaggaatgtccagctgtccgccttatc
actttggaagaagagatgaccaagtacaagccagagtcggatgaattaactgcagaaaag
ataaaagaattctgtgaccgatttttggagggcaaagttaagcctcatttaatgagccag
gacctacctgatgactgggacaagcaacctgttaaagtactagttgggaagaactttgag
gaaattgcttttgatgaaaaaaagaacgtctttgtagaattctatgctccctggtgtggt
cactgcaaacagttggctcctatttgggacaaattgggagagacttataaggaccatgaa
agtatagtcatcgccaagatggactcaacagctaatgaagtagaggcagttaaggtccac
agtttccccacgttaaagttcttccctgcaagtgctgatagaacggtaattgactacaat
ggagagagaacactagaaggtttcaagaagttcctagagagtggtggattagatggggca
ggggatgatgatgatctagaagacttggaagaagctgaagagccagatatggaagaagat
gatgatcaagtagctccaaaagatgaattgtaa

DBGET integrated database retrieval system