KEGG   Sarcophilus harrisii (Tasmanian devil): 100921633Help
Entry
100921633         CDS       T02286                                 

Gene name
PTPN5
Definition
protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)
Orthology
K18018  
tyrosine-protein phosphatase non-receptor type 5 [EC:3.1.3.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100921633 (PTPN5)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100921633 (PTPN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 560 aa AA seqDB search
MVLKNAQPSGGVWTAEHPVGVLLRGSLLSLRDDNDLQTQKNRAKMVNRELKTKISEKLSG
SLVADMAMDLFFNLGTMRAWNPRDRCLPQPIAMEAIDENEGHPDQQGETASPPQSSERET
QPVCLKIGSMETSGFLVVFLAFGLILATILVWHLLGTSPELPPKQPEDRRQSVSRQPSFT
YSEWMEEKTEDDFLDLDPVPETPVFDCSMDIKPEADPTSLTVKAMGLQERRGSNVSLTLD
MCTPGCSEEGFGYIMSPREESAREYLLSASRVLQAEELHEKALDPFLLQAEFFEIPMNFV
DPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDQDDPLNSYINANYIRGYGGEEKVYIAT
QGPIVNTVSDFWRMVWQEHAPIIVMITNIEEMNEKCTEYWPEERVVYDGVEITVKQVIQA
DDYRLRLITLRSGTEERGLRHYWFTSWPDQKTPDRAPPLLQLVLEVEEAAGWEGRSFAPI
IVHCSAGIGRTGCFIATSICCKQLQREGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVM
SLYEKQLSSQAKGPESAALA
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggtattaaagaatgcccagccaagtgggggggtctggacggcagaacacccagtgggg
gtgctgctgcgggggagtcttctcagcctgcgggatgataatgatcttcagactcagaag
aatagagcaaaaatggttaaccgggagttgaaaaccaaaatcagtgaaaagctctctggg
agcctggttgctgacatggccatggatctgttcttcaaccttgggaccatgagggcctgg
aaccccagggacaggtgtctcccccagcccatagcaatggaggctatcgatgagaatgaa
gggcacccagaccagcagggggaaacagcatcacccccacagtcctcggagagagagaca
cagcccgtctgcttaaagataggaagcatggaaacatctggatttctggtggtcttcctg
gcttttgggctgatccttgctacgatcttggtttggcatctcctgggaacttccccggag
cttcccccgaagcaacctgaggacaggcgccagtctgtgagccgccagccatctttcacc
tactcggaatggatggaggaaaaaactgaggatgacttcttggatctggaccctgtcccg
gagacaccggtgtttgactgctcaatggacattaaaccagaggctgatcccacctccttg
acagtcaaagccatgggcctacaagagaggagaggctcaaatgtgtccttgacactggac
atgtgcactccaggctgctctgaggagggttttggctacatcatgtctccacgtgaggag
tcagctcgagagtacctgctcagtgcctcccgggtcctccaagctgaggagctccatgag
aaggcattagacccattcctgctacaggcagagttctttgaaatacccatgaactttgtg
gatccaaaagaatatgacattcctggcctggtgaggaagaatcgctacaaaaccatcctt
cccaacccccacagcagggtatgccttacctcgccagaccaagatgaccccctgaactcg
tacatcaatgccaactatataagaggctatggaggggaggagaaggtgtacatcgccact
cagggacccattgtcaacaccgtgagtgacttctggcggatggtgtggcaagagcacgcc
cccattattgtgatgatcaccaacattgaagaaatgaatgagaaatgcacagagtactgg
ccagaggagcgagttgtatatgacggggtcgagatcacagtgaagcaggtcatacaggct
gatgactaccggcttcgtcttatcaccctgaggagtgggactgaggagcgcggcctgagg
cattactggttcacctcgtggccagaccagaagaccccggatcgggcccccccactgttg
cagctggtcctggaggtggaggaagctgcgggctgggaggggcggagcttcgcgcccatc
atcgttcactgcagcgccgggatcggaaggaccggctgcttcattgccaccagcatttgc
tgcaagcagctgcaacgagagggtgtagtggacatcctgaagaccacttgtcagctccgt
caggacaggggcgggatgatccagacttgcgagcagtaccagtttgtacaccacgtcatg
agcctgtatgagaagcagctttcttcccaagccaaggggcccgagagcgcagccctggcc
tga

DBGET integrated database retrieval system