KEGG   Sarcophilus harrisii (Tasmanian devil): 100921818Help
Entry
100921818         CDS       T02286                                 

Gene name
ARG2
Definition
(RefSeq) arginase-2, mitochondrial
  KO
K01476  arginase [EC:3.5.3.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00220  Arginine biosynthesis
shr00330  Arginine and proline metabolism
shr01100  Metabolic pathways
shr01230  Biosynthesis of amino acids
shr05146  Amoebiasis
Module
shr_M00029  Urea cycle
shr_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    100921818 (ARG2)
   00330 Arginine and proline metabolism
    100921818 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    100921818 (ARG2)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100921818 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 100921818
NCBI-ProteinID: XP_012404377
Ensembl: ENSSHAG00000011895
UniProt: G3WEQ4
Position
1
AA seq 354 aa AA seqDB search
MSLRSRLSRLLQKQGHSVLKKSVHSVAVIGAPFSKGQKRRGVEHGPAAIREAGLLKRLSN
LGCRVNDMGDLSFTPVTNDELYNNLVVNPRSVGLANQELAEAVSRAVSSGHRCLTVGGDH
SLAIGSISGHVRHCPDLCVIWVDAHADINTPLTTLSGSLHGQPVSFLLRELQDKVPSLPG
FSWIKPCLSSPDIVYIGLRDVDPAEHFILKNYDILNFSMRDIDRLGIQKVMEQTFEQLIS
KKQRPIHLSFDIDAFDPSLAPATGTPVVGGLTYREGMYITEEIHNTGLLSALDLVEVNPL
LATSEEEVKATAGLAVDVIASSFGQKREGQHDGYDHLPTPSSPDESDSEECVRI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgagaagcaggctctcgaggcttcttcagaagcaagggcattctgtgctcaag
aagtccgttcactcggtggctgtgatcggagccccgttctctaaagggcagaagcgaaga
ggagtagaacatggtcctgcagccataagagaggcagggttattgaaaaggctctccaac
ttgggttgccgggtaaatgacatgggagatctcagtttcacccctgtgaccaacgatgag
ctctataacaacctggttgtgaatcctcgatcagtgggccttgccaatcaggaattagca
gaagcagttagcagggctgtgtcttctggacaccgatgcctcactgtgggaggagaccac
agtctggcaattggttccattagtggtcatgtccggcactgcccagatttgtgtgttatc
tgggttgacgctcatgctgacatcaacacaccccttaccactttgtctgggagtctgcat
ggacagccagtttctttccttctcagagaactgcaggacaaggtgccatcacttccagga
ttctcctggatcaagccctgtctctcatccccagatattgtatatattggcctaagggat
gtggatcctgctgaacattttattctaaaaaactatgacatcttaaacttttcaatgaga
gatattgaccgccttggaatccagaaggtcatggaacagacatttgaacaactgatcagc
aaaaaacaaagaccaattcatctaagctttgatattgatgcttttgacccttcactggct
ccagcaacaggaactcccgttgtcggtgggttgacttatcgggaaggcatgtatattaca
gaggaaatacataatacaggtttgctgtcagccctggatctggttgaagtcaatcctctc
ttggctacttcagaggaggaagtgaaggccacagctggactggctgtggatgtgatcgcc
tcgagcttcggccagaagagggaaggacagcatgatggctatgaccatctccccactccc
agttcaccagatgaatcagacagtgaagaatgtgttcgaatttag

DBGET integrated database retrieval system