KEGG   Sarcophilus harrisii (Tasmanian devil): 100921846Help
Entry
100921846         CDS       T02286                                 

Gene name
TMX3
Definition
thioredoxin-related transmembrane protein 3
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 467 aa AA seqDB search
MLAWSGTSGQEGEGGQGSPSPVVEVVVLGQTLDTDVVEELDESFKDNRKNSIWLVDFYAP
WCAHCRRLEPVWNEVGLEMKRLRSPVKVGKMDATSYTSIASEFGVRGYPTIKLLKNDLAY
NYRGPRTRDDIIEFAHRVSGALIRPLPSQQMFEHVKKRHRVLFLYVGGESPLKEKYIEVA
SELIVYTYFFSASEEVIPKYVTLNEMPAVLVFKDETYFVYDEYEDGDLKSWVNRERFQNY
LTVDGFTLYELTDTGKLIVIAVIDGKNGTIEHTRLKEVIQEIAKDYRDRFRRDFQFGHID
GSDYVNNLLMDELSIPTVVAINTSNHQYFLPTRHIESTEDVMQFISDILDGTIEARGGDG
ILQRLKRICYDVRTTVVSVFRSSPFLGCFLFGLPLGVISIMCYGIYTADTDGAYTEERIE
VSKRETESIDTREESNEEEKKEENSENSLVLSDAEQEPKDILEKKND
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctggagtggaacttcagggcaggaaggggaaggaggacaggggtcgcctagc
ccagttgtggaggttgttgtacttggtcagactttggatacagatgttgtagaagagtta
gatgaatcatttaaagacaatcggaaaaatagcatttggcttgtagatttctatgcgcca
tggtgtgcacactgcagaagattggaaccagtttggaatgaagttggtttagagatgaaa
aggcttcggtctccagttaaagttggaaaaatggatgctacttcctatactagcattgct
tcagaatttggagttagaggatatccaacgattaagctattaaaaaatgacctggcatat
aactaccgagggcctagaactagagatgatatcattgagtttgctcatagagtatctggg
gcactaatccgtccacttccaagtcaacagatgtttgaacatgtaaagaagaggcatcgt
gtactgtttctttatgttggaggagagtcacctttaaaggagaaatacatagaagtagct
tcagaattaattgtttatacctacttcttttcggcctcagaagaagttatacctaagtat
gtaaccctgaatgagatgcctgctgtgcttgtttttaaagatgaaacttactttgtatat
gatgaatatgaagatggagatcttaaatcatgggtcaacagagagagatttcagaattat
cttactgtggatggcttcaccctctatgaactaacagacacaggaaaacttattgtcata
gcagttattgatgggaaaaatggaacaattgagcataccagattaaaggaagttattcag
gaaatagctaaagattatagagatcgttttcgcagagattttcaatttggacacatagat
ggaagtgactatgtaaacaacctgctcatggatgaattgagtattcccactgtagttgca
ataaatacttcaaaccatcaatattttctgccaactagacatattgagagtactgaggat
gtgatgcaattcatcagtgatattttggatggcacaatagaagctcgaggtggtgatgga
attttgcaaagattgaaaagaatatgttatgatgtcaggactactgttgtgtctgtattt
agaagctcaccatttttgggttgttttctctttggcctgccactgggtgtcatcagcatc
atgtgttatggaatctacactgctgacacagatggagcttatacagaagagcgaattgaa
gtttctaaaagggaaactgaaagtatagatacaagagaagaaagcaatgaggaggaaaaa
aaggaagaaaacagtgagaattctctagtactttcagatgcagagcaagaacccaaagat
atattggaaaagaaaaatgactga

DBGET integrated database retrieval system