KEGG   Sarcophilus harrisii (Tasmanian devil): 100921944Help
Entry
100921944         CDS       T02286                                 

Gene name
TMSB4X
Definition
thymosin beta 4, X-linked
Orthology
K05764  
thymosin, beta 4
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:shr00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100921944 (TMSB4X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 44 aa AA seqDB search
MSDKPDMAEIQKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaaccagatatggccgagattcagaaattcgataagtctaaattgaagaag
acagaaacacaagagaaaaatccactgccttcaaaagaaacaattgaacaggagaagcaa
gcgggtgaatcgtaa

DBGET integrated database retrieval system