KEGG   Sarcophilus harrisii (Tasmanian devil): 100921974Help
Entry
100921974         CDS       T02286                                 

Gene name
NUP205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100921974 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 2014 aa AA seqDB search
MASLLAVNSAASLWGPYKDIWQTVGNAIWRRQPEAVHLLDLILKKHKPDFISLFKNPAKN
VQQHEKVQKASTEGVAIQGQQGTRLLPEQLIREAFILSDLFDIGELAAVELLLAGEHQQP
HFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKTWTLELSPELVSMTTRFTDELMEQ
GLTHKILTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFSWTCQSP
LSKDDTLLLIGHLERVTVEASGSLDSVNLALVMALLYCFDISFIEQGAEDREDIIHQLPL
LTERQYISSIHSRLQDSQPWKLPGLQATVRLAWALALRGISQLSDVPALAEFTEADEAMA
ELAIADNIFLFLTESVVGSENFYQEEFYIRRIHNLITDFLALMPMKVKQLRNRADEDARM
IHMSLHMGNDLPISLRRDLEHLMLLIAELYKKNPFNLELALEYWCPSEPLQTSTIMGSYL
GVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLASGPQCAHYCFSLLKVNGSS
HAENIQGAGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPLRGITQKEQDGLIAF
LQLTTTIITWSENARLALCEHPQWTPVVVILGLLQCSIPPILKAELLKTLTAFGKSPEIA
ASLWQSLEYTQILQTVRIPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQM
EDFVDQFVELRGEEIIAYKPPGFSLMYHLLNESPMLELSLSLLEEGVKQLDTYAPFPGKK
HLERAVQHCLALLNLTLQKENLFMDLLRESQLALIVTPLEQLLQGINPRTKKADNVVNIA
RYLYHGNSNPELAFESAKILCCISCNSNIQIKLVGDFTHDQSVSQKLMAGFVECLDSEDA
EEFISPEEELEPDKKLARIRHETRIHILNLLITSLERNPPNLALYLLGFELKKPVSTTNL
QDPGVLGCPRTCLHAILNILEKGTEGRTGPMAVKESPQLAELCYQVIYQLCACSDTSGPT
MRYLRTSQDFLFSQLQHLPFSNRECEISMLNQMSWLMKTASIELRVTSLNRQRSHTQRLL
HLLLDDMPVKPYSDGEGGIEDENRSVSGFLHFDTATKVRRKILSILDSIDFSQEIPEPLQ
LDFFDRAQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEIS
TILQYVVGRNKLLQCLHAKRHALESWRQLVEIILTACPQDLIQAEDRQLIIRDLLQDVHD
KILDDDAAQELMPVVAGAVFTLTAHLSQSVRTEQKQPQPPPLAAAGPGESQFLMLDSSFT
SPPMTECMNVGFASIGDSSLHIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQMAQRPD
EPDTLEAAKKTMWERLTAPEDAFSKLQRENIAIIESYGAALMEVVCRDACDGHEIGRMLA
LALLDRIVSVDKQQQWLLYLSNSGYLKVLVDSLVEDDLTLQSLLSPQPPLLKALYTYESK
MAFLTRVAKIQQGALELLKSGVIVRLAQCQVYDMRPEIDHQGLFGIREPPVFIPAPVDRY
RQILLPALQLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDVSAGSLQELALL
TGIISKAALPGVLSELDVDVTEGSLMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKFQDG
VDGDRMNKRDEIELAMQQICANVMEYCQSLMLQSSPTFQHAVCLFTPSLSETINREGRQD
TQAPVVPYWRLPGLGIIVYLLKQSANDFFTYYDSHRQNVNKLQNVEQLPPDEIKELCQSV
MPAGVDKISTSQKYILGRRRLVKLINNRAKLLSLCSYIIETCLFIFWRHLEYYLLRCTPT
DSQDSLLASTATFKSRRLQDAFTSETNLDFRSGLTRVSQHDIEQLQIEAINVFGESLQKK
LLDIEGLYSKVRSRYCFIQALVRRIRGLLRLSRA
NT seq 6045 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgttgttggcggtaaattcggctgctagcctctggggtccatacaaagacatc
tggcaaacagtgggaaacgccatttggagaagacaacctgaagctgtccatcttcttgac
ctgattttaaagaaacacaaacctgatttcatctcattattcaagaatccagccaaaaac
gttcagcagcatgagaaggttcagaaggcaagtacagaaggagttgctatccagggtcag
caaggaactcgacttcttcctgagcagctcattagagaagccttcatccttagtgacctc
tttgacattggtgaactagctgctgttgaacttcttttggctggagaacaccagcagcct
cattttcctggtcttacaagaggattagtagcagttcttttatattgggatggaaaacga
tgcattgcaaattctctcaaagccttgatacagtcacggcgaggcaagacatggacacta
gaactaagtcccgagctggtttccatgacaacacgttttacagatgaactaatggaacaa
ggattgactcataaaatcctaactctggtgtctcaaattgatgtgaataatgagtttgag
aagttacagcgggaaagaggcttgggcagtgaaaagcatcgcaaagaggtttcagatctt
atcaaagaatgccgccaatctttggcagaaagcctattttcctggacctgccagtcacct
ttaagcaaagatgatactctgctccttatcggccatctagaaagagtcacagttgaagct
tctggctcattggatagtgtgaacttggctctcgtcatggctctcctttattgctttgat
atcagttttatagaacagggtgcagaggaccgagaagatataattcatcaactaccacta
ttaacagagagacagtatatttcatcaattcactcgcgccttcaagactcacagccttgg
aaactacccggcctacaagccactgttagacttgcttgggcattggcattgcgagggatt
tctcagctctctgatgtgccagctcttgctgaatttacagaagccgatgaagcaatggca
gagcttgcaattgcagataatatcttccttttcttaactgagtctgtagtggggtcagaa
aatttctaccaggaagaattttatatccgcagaattcataatctcatcacagacttcctt
gcacttatgccaatgaaggtgaaacagttaagaaatagagcagatgaagatgctcgaatg
attcacatgagtttgcatatgggtaatgaccttcctatttcacttcggagagatctggaa
catcttatgcttttgattgctgagctgtataaaaaaaacccttttaatttggagcttgct
ttggaatattggtgtccttcagaacctctccagacttccactataatgggatcctattta
ggggtagctcatcagagaccccctcaacgccaggttgttttatcaaagtttgttaggcaa
atgggagacctacttcctcctactatttatattccatatctgaaaatgctccagggattg
gccagtgggccacagtgtgctcattactgtttcagtttgttgaaagtcaatggcagtagt
catgctgaaaacattcaaggagcaggtggcagtcctgtgtcttgggaacatttctttcac
tctttgatgctgtatcatgaacatttaaggaaagatctgccaagtgcagatagtgtccag
taccggcatctccctttacgaggcatcacccagaaagagcaggacggattgattgctttt
ttgcaacttacaactacaatcattacatggagtgagaatgctcgtttggctctctgtgag
catcctcagtggactcctgtggttgtcatcctgggactcctgcagtgtagcatccctcct
attttgaaagctgagctattgaagacacttacagcctttggaaaatctcctgaaattgct
gcttccctctggcagtctttggaatatacacagatactacagactgtaaggattccaagc
cagagacaagcaattggcattgaggttgaactaaatgaaatagaatcaaggtgtgaagaa
tatccactgacaagggccttttgtcagcttattagcacactagtagaaagttcatttcca
tctaacttgggggctggactacgtccacctggctttgacccatacttgcagttcctcagg
gattctgtgtttcttcgatttcgcaccagagcttatcgcagagcagctgaaaagtgggaa
gttgctgaggtggtgcttgaggtgttttataaactgctcagagattatgaaccccagatg
gaagattttgtggaccagtttgtagaattgagaggtgaagaaatcatagcttataaacct
ccaggatttagtttgatgtatcatcttctgaatgagtcaccaatgctggagctctctctt
agtttgttggaagaaggagttaaacagcttgatacctatgcacctttccctggaaagaaa
catttggagagagcagtgcagcactgccttgctcttctcaatttaactctgcagaaggag
aatctcttcatggatcttctaagagaaagtcaactggctctaatagtcactccactggaa
cagctattacaaggcatcaatccccgaacaaagaaggcagacaatgtggttaacattgcc
aggtatctgtatcatggcaatagcaatcctgagttggctttcgaaagtgccaagatcctt
tgctgtatctcttgcaattctaacattcagataaaattagtaggagatttcacacatgat
cagagtgtaagccagaagctgatggctggatttgtggaatgtttggatagtgaagatgca
gaggaattcattagtccagaagaggaattagaacctgataagaaattagcacgaatccgc
catgaaacaagaatccacatcttgaatcttcttatcacttctctggagcgcaatcccccc
aaccttgccttgtatcttctgggctttgaattgaagaaacctgttagtactacgaacctc
caggatccaggagtcttaggttgccctcggacttgtcttcatgccatattaaatatcttg
gagaaaggaacagaagggagaactggcccaatggcagtaaaggaatcacctcaacttgca
gaactgtgctaccaggttatttatcagctgtgtgcatgctcagatacatctggtccaact
atgaggtatttgagaaccagccaagattttttattttctcagttgcagcatttgcctttt
tctaacagagaatgtgaaatatccatgctgaaccaaatgtcatggcttatgaagactgcc
tcaatagagctaagagtaacttctcttaatcgccagcgctctcacacgcaaagacttctg
cacctattgctagatgatatgccagtcaaaccttactcagatggtgaaggaggaatagaa
gatgaaaatagatctgtcagtgggttccttcactttgatactgccacaaaagtacgtcga
aaaatactaagtattttagattcaattgacttcagtcaggagattcctgagcctttgcag
ttggatttctttgatcgtgctcagattgagcaagtcattgccaattgtgaacacaagaat
ttgaggggacaaacagtttgcaatgtcaagcttcttcacagggttcttgtggcagaagta
aatgcgcttcaaggtatggcagctataggtcagagacctttgcttatggaggaaatcagc
actattctacagtatgttgtgggcagaaacaaattgttacagtgccttcatgcaaaacga
catgcgcttgagtcatggaggcagctggtagaaattattctgactgcttgtcctcaggac
ctcatacaggcagaagataggcaactgattattcgtgacctcttacaggatgtacatgat
aagatattggatgatgatgcagcccaagaattaatgccagttgtggcaggggccgtgttt
accttgacagctcatttgagccagtctgtgcggacagagcagaagcagccacagccaccg
cccctcgctgctgctgggcctggggaatcccagtttttgatgcttgatagttctttcacc
tcgccacctatgacagagtgcatgaatgtggggtttgcttctattggagattcctcactt
cacatcatattgaagaaactcttagacttcattttgaaaacaggtggtgggttccagcga
gtgaggacacacttgtatggctctttgctttattatttacagatggcccagagaccagat
gaaccagacactttagaagcagccaagaagactatgtgggaacggctaacggcacctgaa
gatgctttcagtaaattgcagcgagaaaacatagctatcattgagagttatggagcagcc
cttatggaagtagtctgtcgagatgcctgtgatggtcatgaaattggaagaatgttggcc
ctggcgttgcttgatcgaattgtgtctgtagataaacaacagcagtggctcttgtatctc
tctaacagtggttacttgaaggtgcttgtggacagtctggtggaagatgaccttactctt
cagagcttgcttagtccccaacctcctcttttgaaagctctctatacttatgaatccaaa
atggcattcttgacaagagtggccaaaatacaacaaggagcattagagctgctgaagtct
ggtgtgattgtgagactggcacaatgccaagtctatgacatgcgtccagaaatagaccat
cagggactgtttggcataagagaacctcctgtattcattcctgcccctgtggaccgatat
cgccagattcttcttcccgctctccagttgtgccaggtcatcctcacatctagtatggct
cagcatctgcaggcggcaggacaggtgttgcagttcctcatttctcactctgacaccatt
caagcaatattacgttgtcaggatgtcagtgcagggtccctgcaagagctagccctcctc
acaggaatcattagcaaagctgcattacctggagtgctaagtgaactagatgttgatgta
actgaagggtctctgatggagctacagggtcacatagggcgattccagcgccaatgctta
ggactactaagtcgctttggtggttcagacagactacgccaatttaagtttcaagatggt
gtggatggtgatagaatgaacaagagagatgagattgaactggctatgcaacagatttgt
gccaatgtcatggaatattgtcagtcactcatgttacagagttctccaacatttcagcat
gcagtgtgtctcttcacccccagtctttctgaaaccattaacagagagggacgacaagac
actcaagctccagtagttccgtattggcgtctgcctggcttaggcattattgtctacttg
ctgaaacaaagtgctaatgatttcttcacttattatgacagtcatcgacagaatgtcaac
aaactacaaaatgtagaacagcttccccccgatgagataaaagagttgtgccagtcagta
atgccagctggagttgataaaatctccacatcccagaagtacatcttggggagacggcgt
ttggtgaagttgatcaacaatcgagccaaactgctctccctttgttcttatatcatagag
acctgcttatttattttttggcgccacttagaatactatctattacggtgcactcccact
gattcccaagattctctactggcttctacggctacatttaaaagtaggaggttacaagat
gctttcacttcagagacaaatttggatttcagaagtgggttgactcgagtgagccagcat
gatatagagcagcttcagattgaagccatcaatgtctttggtgaatcactgcaaaagaag
cttctggatattgaaggattatactccaaagttcgatcccgctattgtttcatacaagca
cttgtcaggcgcatccgtggtttattaaggctgtcaagagcctga

DBGET integrated database retrieval system