KEGG   Sarcophilus harrisii (Tasmanian devil): 100922088Help
Entry
100922088         CDS       T02286                                 

Gene name
KAT6A
Definition
K(lysine) acetyltransferase 6A
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100922088 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1993 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNLGKLDGKQNVDWNKLIKRAVEGLAESSGSTLKN
IERFLKGQKDVSALFGGSAASVFHQQLRLAVKRAVGHGRLLKDGPLYRLNTKAANVDGKE
SCESLSCLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLHKKAAQIKRRYANPIGRPKNRLKKQNTVSKGPFSKVRTGP
GRGRKRKITLSSQSASSSEEGYLEQMDLDFCRDGSTPLKFNKKTKGLIDGLTKFFTPSPD
GRKARGEVVDYSEQYRIRKKGNRKSSTSEWPTDNQDGWDGKQENEERLFGSQEDMTEKDM
ELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEF
CLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLD
HKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFL
IDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGI
CPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQVNLRPVDVDPECLRWTPVIVS
NSVVSEEEEEDAEEGENEEQQCQEKELDSSMSKSVSWEKKEDSYSIENEKKPDIIAPANS
ARLNKEVLPLDSLPANSQPSRRGRWGRKNKKVREPFSEKDSKLPLEETPLVPRGRYGECE
EKSEASQEQFTESEEHSTALEGRFGKDEKPEVPKRRLNENVEIWRGPLKKSPEPLKCRLP
EGSDRLPHRYNDGDRAILRGFSESSEEEEEPESPRSNSPPVLTKPTLKRKKPILHRRRRV
RKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIDEEEEEEDENELFSRG
YFNCLPSQEVLRHRSSSKRKSKDIEEESDDADGTPILKPVSMLRKCDVRDSPLEPDTSTP
LKKKKGWPKGKSRKPIHWKKRPGRKPGFKLNREMITVSQECRPDPMVPLPKAGRKPKIQD
KEEVAEPKEDLPLAEERKENDIHGETEEAGEGEDEDTTSSEVRAASPVDSRGSPVTESKE
PEIEEEVEEKPRVSEEEQRQSEEEQAELEEQEHEEEDEVALGTNQNEDHDADDEDDGHLE
STKKKESEEQTIREGVKEEPGGQESFLETNTQSNREEIKSKNETDPDSEEEQASHETSVV
SEHMPGSEDDHEEEASTKGELIELKEEEEIPHSELDLETVQAVQSLTQEESNEHDGTYQD
CEETLAACQTLQSYTQADEDPQISMVEDCHASEHNSPISSVQSHPSQSVRSVSSPNVPAL
ESGYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYEN
PSSYDSTMGGSICGNNSSQSSCSYGGLSSSSSLTQNSCVVTQQMANMGSSCSMMQQNNVQ
PAANCNIKSPQSCVVESPPSNQQQPPAPQQQQQQQQQQAAPPPPQQQPQPQSQPQPQPPQ
PPPPPQQQPPLSQCSMNNSFTPAPMIMEIPESGSTGNISIYERIPGDFGASSYSQPSATF
SLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPLAGAPQAQATMT
PPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKSAPLPSAAAHQ
QQLYGRSPPAVAMQAGPRALAVQRGMNMGVNLMPTTPYNVNSMNMNTLNAMNSYRMTQPM
MNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTGPSHHSYMNTAG
VPKQSLNGPYMRR
NT seq 5982 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgctaacccgctgtatacggagtggatattggaggcgatcaaaaaagta
aagaagcaaaaacagcgtccttcagaagagaggatatgcaatgccgtgtcttcgtcccat
ggcttggaccggaaaactgttttggagcaattggagttgagtgttaaagatggaacaatt
ttaaaagtctcaaataaaggactcaattcctacaaagatcctgataatcctgggcgaata
gcacttcctaaacctcggaaccttggaaagttggatggcaaacaaaatgtggattggaat
aaacttatcaaacgggcagttgaaggcttggcggaatccagcggttcaaccttgaagaac
attgaacgttttttgaaaggtcagaaagatgtgtctgcattgtttgggggcagtgctgcc
tctgtctttcaccagcagttacgattggctgtcaaacgtgccgttggccacggcagacta
cttaaagatggacctctttatcggctcaacactaaagcggccaatgtggatgggaaagag
agttgtgagtctctttcctgtctacctcctgtgtctctccttcctcatgaaaaggataag
ccagttgctgaaccaattccaatctgtagtttttgtcttggtacaaaggaacaaaaccga
gagaagaaaccagaagagctcatctcttgtgctgattgtggcaacagtggtcatccatcc
tgtttaaagttctctccagagttaacagttcgagtaaaggccttacggtggcagtgtatt
gagtgtaaaacgtgcagctcttgtcgagaccagggcaaaaatgcagataacatgctcttc
tgtgattcgtgtgaccgaggttttcacatggaatgctgtgatccgccactcaccaggatg
ccgaaaggcatgtggatatgtcagatttgtcgacctcggaaaaaaggaagaaaacttcta
cataaaaaagcagcacagataaaacggcgctatgccaatccaataggacgccccaaaaac
aggttaaagaagcaaaatacagtatcaaaaggccctttcagcaaagttcgaactggacct
ggtcggggtcggaaacgtaaaatcactctctccagccaatcagcatcttcatctgaagaa
ggctatttggagcaaatggacttagatttctgcagagatggtagtacacccctgaaattc
aataagaaaaccaaagggctcattgacggccttaccaaattcttcaccccttcccctgat
gggcggaaagctcgtggggaagtggtggactactctgagcaatacaggatcaggaaaaag
ggcaacaggaaatcaagtacttcagagtggcccacagacaatcaggatggctgggatgga
aaacaggaaaatgaggagcgactttttggaagtcaggaagacatgactgaaaaagatatg
gaattatttcgagatatccaggaacaagcactgcagaaagttggagtgactggtccccct
gatccacaagtccgctgtccctctgtcattgagtttggaaaatatgaaattcatacctgg
tactcctccccatatccacaagaatactcaaggctgcctaagttgtacctttgtgaattt
tgtctaaagtatatgaaaagtagaactattctacaacagcacatgaagaaatgtggttgg
ttccaccctcctgctaatgagatttacagaaagaataatatctctgtctttgaggttgat
ggaaatgtcagtacaatttactgtcaaaacttgtgcctattggcaaagctgtttcttgac
cacaagacactctattatgatgtggaaccatttcttttctatgtgttaacacagaatgat
gtcaaaggttgccatcttgttggctacttctctaaggaaaagcactgccaacagaagtac
aatgtttcctgcataatgattcttccacagtaccagcgcaagggttatggcaggttcctc
attgacttcagttatttgttgtcaaagcgtgaaggtcaagctggatctccagagaaacca
ttatctgatttagggcgtctttcctatatggcttattggaaaagtgtaatattggagtgc
ctttatcaccaaaatgacaagcaaattagcattaaaaaattaagcaaattgactggaatc
tgccctcaagacattacttccacactccatcacctacgaatgctggacttccgtagtgac
caatttgtaattatccgccgggaaaaactgatccaggatcatatggcaaaactccaagtg
aatctgagacctgtagatgtagatcctgaatgcttgcgttggactcctgtcattgtctcc
aattctgtagtctcagaggaagaggaagaggatgcagaggaaggagaaaatgaagagcag
cagtgccaggaaaaggaactggattccagtatgtcaaagtcggtgtcttgggagaaaaaa
gaagattcttattcaattgagaatgaaaagaaaccagatattattgcaccagctaattct
gcacgactaaacaaggaagttcttcccctagatagtcttccagcaaatagtcaaccatct
cggagaggccgatggggacgtaagaacaaaaaagtccgagagccttttagtgagaaagat
tctaaacttcccttggaagaaacaccattggttcctcggggaagatatggcgaatgtgag
gaaaaatctgaagcctcccaggaacagttcactgagagtgaagagcattcgacagcttta
gagggtcggtttggcaaagatgaaaaaccagaagtccccaaaagacgactaaatgaaaat
gtagagatatggcgaggaccactgaagaaaagcccagagcccctcaagtgcagattacca
gaagggagtgatcgactgcctcaccggtataatgatggagacagagccattttgaggggc
tttagtgagagtagtgaagaggaagaagaacccgagagtcctcggtcaaattcaccacct
gtgcttactaaacccacattaaaacgaaagaaaccaattcttcaccggagaaggagagtc
cgaaagcgaaaacaccacaatagcagtgtggtcacagaaactatctctgagaccacagaa
gtgttagatgaaccctttgaggattccgactctgagaggccaatgccaagattagaacct
acatttgaaattgatgaagaggaggaagaagaggatgaaaatgaactgttttccagagga
tactttaattgtttaccctcccaggaggtccttaggcatcgatcttcttctaagaggaag
tctaaagatatagaggaagaatcagatgatgctgatggcactcctattctgaagccagtg
tccatgttgagaaaatgtgatgtgagggattccccacttgagccagatacttctacacct
ttgaaaaagaagaagggatggcccaaaggcaaaagtcgcaaaccaatccactggaagaaa
agacctggccgaaaaccaggattcaagctgaaccgagaaatgataacagtatctcaagaa
tgtagacctgaccccatggtaccccttcctaaagctggacgtaagcctaaaattcaagac
aaagaagaggttgctgaaccaaaagaagacttgccccttgctgaagaaaggaaggagaat
gatatccatggagaaacagaagaggcaggagagggagaagatgaggatacaactagcagt
gaggtgagagcagcttccccagtggacagtcgtggtagcccagtgacagaatctaaagaa
cccgagatagaagaagaggttgaggagaaaccccgggtttcagaagaagagcaaaggcaa
tcagaggaagagcaggcagagctggaagagcaggaacacgaggaagaggatgaggtggct
ctgggaacaaaccagaatgaggaccatgacgcagatgatgaagatgatggtcacttagaa
tccacaaagaaaaaggaatcagaggaacagacaattagagaaggagtcaaagaggagcct
gggggtcaggaatcttttttagaaacaaatacccagagcaatcgagaggaaataaagagc
aaaaatgaaacagaccccgattctgaggaagaacaggcttcccatgagacatcagttgta
tcagagcatatgccagggtctgaggatgaccatgaagaagaagcaagcactaaaggagaa
ttaattgaattaaaagaagaagaagagattcctcatagtgaattggatctggaaacagtg
caagcagtacaatcactgacccaggaagaaagcaatgagcatgatggaacataccaggac
tgtgaagaaacacttgcagcttgtcaaactttgcagagttatacccaagctgatgaagac
cctcagatatcaatggtcgaagactgccatgcgtcagaacacaacagcccaatatcttct
gttcagtctcatcctagccaatcggtccgttcagtcagcagtcctaacgtgcctgctctt
gagagtggttatacccagatcagccctgaacaaggatccctgtccgcaccctctatgcag
aacatggagaccagccccatgatggatgtgccttcggtgtcagaccactctcagcaggtg
gtggacagtggcttcagtgacctgggcagcattgagagcaccacagaaaattatgagaac
cctagcagctatgattccactatgggcggcagcatttgtggaaataactcttcacagagc
agttgctcttatggaggattgtcttcctccagtagcctcactcagaacagttgtgttgtc
actcaacagatggccaatatgggcagtagctgtagcatgatgcagcagaacaatgtgcaa
cctgctgccaactgtaacatcaagtcacctcagagttgtgtggtggaaagccccccgagt
aaccagcagcagccgcccgcaccgcaacagcaacagcagcagcagcagcagcaggcagca
ccgccacctccccagcagcagccccagccccagtcccagccccagccccagcctcctcag
ccccctccgccaccccagcagcagcctccactgtcacagtgcagtatgaataacagcttc
accccagccccgatgatcatggaaataccagaatccggaagcactgggaacataagtatt
tatgaaaggattccaggggattttggtgccagcagctattcccaaccatcagccaccttc
agtttagctaagttacagcagctgacaaacaccattatggacccacatgccatgccttat
agccattctcctgctgtgacttcctatgcaaccagtgtttctttgtccaacacaggactg
gctcagctagctccatcccatccattagctggggcccctcaagcacaagccaccatgacg
ccacccccaaacttggcatccactaccatgaacctcacctcacctctgctccagtgcaac
atgtctgccaccaacattggcattccccacactcagaggttgcaaggacaaatgccagtc
aaggggcacatttccatccgttctaaatcagcaccactgccctcggcagctgctcaccag
cagcagctttatggtcgcagcccgccagcagttgccatgcaggctggccctcgtgcatta
gctgttcagcgtggtatgaacatgggggttaatttaatgccaacgaccccttataatgtc
aattccatgaatatgaacactttgaatgccatgaatagttaccgaatgacacagcccatg
atgaacagcagttaccatagtaaccctgcctacatgaaccagacagcacagtatcctatg
cagatgcagatgggaatgatggggagccaggcctatacccagcagcctatgcagccaaac
cctcatgggaacatgatgtacactggcccctcccatcacagctacatgaatactgctggc
gtgcccaagcagtctcttaatggaccttacatgagaagatga

DBGET integrated database retrieval system