KEGG   Sarcophilus harrisii (Tasmanian devil): 100922424Help
Entry
100922424         CDS       T02286                                 

Gene name
PFN3
Definition
profilin 3
Orthology
K05759  
profilin
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:shr04015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:shr04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:shr05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 137 aa AA seqDB search
MGDWKTYISAVLRDQRIDDVAVVGHSDNRCVWASRPGGLLAAISPQEVGILTGPDRRSFL
QSGISLAGRRCCVIRDHLLEEDDGVLDARTKGLDGRSVCVGLTPKALIVLMGRRGVHGGT
LNKTAHHLIRGLRFQGI
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggggactggaagacatacatcagcgccgtacttcgagaccagcgcatcgatgacgtg
gcggtagtgggacattcggacaaccgctgcgtgtgggcctcgaggcctggaggcttgctg
gctgccatctccccgcaggaggtgggcatattgacgggccctgaccgccgcagcttcttg
cagtcggggatcagtctggcgggccgacgctgctgcgtcatccgagaccacctgctggaa
gaagacgatggtgttctggacgcccggaccaagggactagatggtcgatctgtgtgcgtg
ggactcacgcccaaggccctgatagtgctcatgggccgacggggcgtgcacgggggcaca
ctcaacaaaactgctcatcatcttattaggggcctgcggttccaggggatctag

DBGET integrated database retrieval system