KEGG   Sarcophilus harrisii (Tasmanian devil): 100922424Help
Entry
100922424         CDS       T02286                                 

Gene name
PFN3
Definition
profilin 3
Orthology
K05759  
profilin
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100922424 (PFN3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100922424 (PFN3)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100922424 (PFN3)
Exosome [BR:shr04147]
 Exosomal proteins
  Proteins found in most exosomes
   100922424 (PFN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 137 aa AA seqDB search
MGDWKTYISAVLRDQRIDDVAVVGHSDNRCVWASRPGGLLAAISPQEVGILTGPDRRSFL
QSGISLAGRRCCVIRDHLLEEDDGVLDARTKGLDGRSVCVGLTPKALIVLMGRRGVHGGT
LNKTAHHLIRGLRFQGI
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggggactggaagacatacatcagcgccgtacttcgagaccagcgcatcgatgacgtg
gcggtagtgggacattcggacaaccgctgcgtgtgggcctcgaggcctggaggcttgctg
gctgccatctccccgcaggaggtgggcatattgacgggccctgaccgccgcagcttcttg
cagtcggggatcagtctggcgggccgacgctgctgcgtcatccgagaccacctgctggaa
gaagacgatggtgttctggacgcccggaccaagggactagatggtcgatctgtgtgcgtg
ggactcacgcccaaggccctgatagtgctcatgggccgacggggcgtgcacgggggcaca
ctcaacaaaactgctcatcatcttattaggggcctgcggttccaggggatctag

DBGET integrated database retrieval system