KEGG   Sarcophilus harrisii (Tasmanian devil): 100922477Help
Entry
100922477         CDS       T02286                                 

Gene name
PPOX
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:shr00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 407 aa AA seqDB search
MGARQVSELGLDSAILPVPGNHPAAQNRFLYVGGTLHPLPTGLRGLFLPAPPFTKPLFWA
GLRELTTPRGMEPDETVHSFAERRLGPEVASIAMDSLCRGVFAGDSRVLSIRSCFPSLFK
AERTHRSVLLGLLRGSGQSPLLDSPLINQARAERWSQWSLRGGLETLPQALGTHLSHQGV
DVLKGQAVCGLNFQSGRWQVSLEDSSLEADHIISAVPAAVLSELLPSEAAPLAQSLDPIY
AVSVAVVNLQYQGVHLPVQGFGHLVPSSEDPGVLGVVYDSVAFPEQDGSPGSLRVTVMLG
GAWLQALESGGQKLSQELFQQQAQKAVATQLGLKKPPTQSLVSLHKSCIPQYTLGHWQRL
EAAAQFLAKHQLPLTLAGASYEGVSVNDCIESGRRAAAQVLNAIPDL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgggagccaggcaggtctctgagcttggtttggattctgcaattttgccagttcccggg
aaccatcctgccgctcaaaatcgattcctgtatgtggggggaaccttgcaccccctgcct
actggcctcaggggactgttccttccagccccccctttcaccaagcccctgttctgggct
gggcttcgggagctgactactcctaggggtatggaacctgatgagactgtgcacagtttt
gcagagaggcgcctgggacctgaggtggcttctatcgccatggacagtctatgtcgagga
gtatttgcaggagacagtagagttctcagtatccgctcctgtttccccagtctctttaag
gctgaacggactcatcgatctgttttgctggggttgctacggggttcagggcagagcccc
ctactagattcacctctgattaatcaggccagagctgagcgttggagccagtggtctctt
cggggagggctggagacactgccccaggccttgggcacccatctgagtcatcaaggagtc
gacgttctaaagggtcaggcagtttgtggactcaacttccagtcaggtcgatggcaggta
tctctggaggacagcagcctggaggctgatcacatcattagtgccgtccctgctgcagtg
ctaagtgagctgcttccctctgaggcggcccctctggcccagagcctggaccctatttat
gctgtatctgtggctgtggtgaatttgcaatatcagggggttcatctgcctgtccagggg
tttggacacctagtgccatcttctgaagaccctggtgtcctgggagttgtatacgattct
gttgccttccctgaacaggacgggagtcctggcagtcttagagtaacggtgatgttgggg
ggagcttggctacaggccctggagagtggagggcagaagctatctcaggaactattccag
caacaagcccagaaagcagttgccacacagttggggctaaaaaagcctccaactcaaagt
ctggtcagcctacataagagctgtattcctcaatatactttgggccactggcagagacta
gaggcagctgcccaatttctggccaaacatcagctgcctctgactctagctggagcatct
tatgaaggtgtttctgtcaatgactgcattgagagtgggcgtcgggcagcagctcaagtc
ttgaatgctattcctgacctttga

DBGET integrated database retrieval system