KEGG   Sarcophilus harrisii (Tasmanian devil): 100922488Help
Entry
100922488         CDS       T02286                                 

Gene name
ALDH1L2
Definition
aldehyde dehydrogenase 1 family, member L2
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    100922488 (ALDH1L2)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     100922488 (ALDH1L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 985 aa AA seqDB search
MVRGRADVSLAPGRRALAPRGPGAAAGGLRGVASAGPSLCQLEGGVPCSPRGRRASGEAR
PPGGPRLHSSRPCRACAVVYYKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKD
GKADPLALAAEKDGIPVFKFPRWRIKGKTIKEVIEAYRSVGAELNVLPFCTQFIPMDVID
CPKHGSIIYHPSILPRHRGASAINWTLILGDKKAGFSIFWADDGLDTGPILLQRECDVEP
NDTVDSLYNRFLFPEGIKAMVEAVQLIADGKASRIPQSEEGATYEGIQKKENAKISWDHP
AEALHNWIRGHDKVPGAWAEIDNQVVTFYGSSLLSGSVPPGEPLTIKGAEKPGLVTKNGL
VLFGNDGKMLIVRNIQFEDGRMIPASKYFSAGEACVVELTDEEKKVAQEIKAIWAGILSN
VSAIEDSTDFFKSGASSMDVVRLVEEIRQKCGGLQLQNEDVYMATKFGDFIQMVVRKLRG
EDQEEELVVDYVSKDINHMTLKMPHQCFINGQFVDAEDGRTYDTINPTDGSTICKVSYAS
VADVDKAVAAAKDAFENGEWGRMNARERGRLMYRLADLMEEHQEELATIETIDSGAVYTL
ALKTHVGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGICAIIIPWNYPL
MMLAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSAKAGFPKGVINIIPGSGGLAGQRL
SEHPDIRKLGFTGSTAIGKQIMKSCAVSNLKKVSLELGGKSPLIIFSDCELDKAVRMGMG
AVYFNKGENCIAAGRLFVEESIHDEFVHRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLDK
LLQYCETGVREGATLVYGGRQVPRPGFFMEPTVFTDVEDHMYLAKEESFGPVMVISKFKN
GDIDGVLQQANNTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQ
SGFGKDLGEEALREYLKTKAVTLEY
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atggtgcggggccgcgccgacgtgtcgctagcacccgggaggcgcgcgctcgccccgcgg
gggccgggagcggcagcgggcgggcttaggggcgttgcgtcagccgggccgagcctctgc
cagctggaggggggcgtgccctgctctccgaggggccggcgggctagcggggaggctcgg
ccgcccggggggcctcgcctccactcgtcgcggccctgccgagcctgcgcggtggtttat
tataaaaataagctgaagctggcacttataggccagagtctctttgggcaagaagtctat
agccacctccggaaagaaggccatcgggtggttggagtgttcacagttccagacaaggat
ggtaaagctgatccattagctttggctgcagagaaagatggcatcccagtttttaagttt
cccagatggagaatcaaaggcaagaccatcaaggaagtcattgaagcctatagatccgta
ggagctgagctgaatgttcttcccttctgcacacagtttattcccatggatgtgattgat
tgcccgaagcatggttctattatctatcacccatctatccttccccgtcaccgaggagct
tctgctatcaactggactttaattctgggagataagaaagccggtttttccatcttctgg
gcggatgatggtctagatactgggcctattctccttcaaagggaatgtgatgtggaaccc
aatgatacagtggattccctttataatagatttctcttcccagagggaattaaggccatg
gtggaagctgtccagctcatcgccgatggcaaagcttctcgtattcctcagtcagaggaa
ggagcaacatatgaaggcatccagaaaaaagaaaatgccaagatttcttgggatcatcct
gcagaagctttgcacaactggatacgaggtcatgacaaagtgcccggagcttgggcagaa
atagacaaccaggtggttactttctatggctcatcattactgtctggttctgtgccacct
ggagaacccttaacaatcaaaggtgctgagaaacctggtcttgtcaccaaaaatggactg
gtcctttttggtaatgatgggaaaatgctaatagtaagaaatattcaatttgaagatgga
agaatgatccctgcttctaaatacttctcagcgggggaagcatgtgtggtagaactcaca
gatgaggagaagaaagtggcccaagaaatcaaggccatctgggcaggcattctgagtaat
gtttctgccattgaggactccacagacttctttaaatctggagcaagctcgatggatgtt
gtcaggctggttgaagagattcgacagaaatgtggcggacttcagctgcagaatgaagat
gtgtacatggccaccaagtttggagacttcattcagatggtggtgagaaagttgaggggt
gaggaccaagaagaagagctggtcgtggactatgtttcaaaagacatcaatcatatgacc
ctgaaaatgccgcatcagtgtttcatcaatgggcagtttgtggatgccgaagatggacgg
acttacgacaccatcaaccccaccgacggatctaccatatgtaaagtgtcttacgcttca
gtggctgatgttgacaaagcagtagcagccgctaaagatgcctttgaaaatggtgaatgg
ggaagaatgaacgccagagaaagagggagattaatgtacagacttgcagacttgatggaa
gaacaccaggaagagctagcaaccattgagaccattgactcgggggccgtgtacacctta
gctctgaagacccacgtcggcatgtctgtgcaaaccttccgatactttgcaggctggtgt
gacaaaattcagggttctacaattccaattaaccaagcacgccccaaccgtaacctgacc
ttcaccaagaaagaacctctaggcatctgtgcaattatcattccttggaattatccctta
atgatgctggcgtggaagagcgcagcctgtctggcagcagggaatactttggtgctcaag
ccagcgcaggtcacacctctgacggccctgaagtttgcagagctctccgccaaggccggc
tttccaaagggagtgatcaatatcattcctggctcaggtggcttagctggacagcgctta
tctgaacacccagacattcgcaaactcggcttcacgggttccacggcgattggcaaacag
attatgaagagctgtgctgtgagtaacttgaagaaagtttccctggaacttggtggcaag
tccccgctgatcatattcagcgactgtgaactcgacaaagctgtgagaatgggcatggga
gctgtttatttcaacaagggagagaactgtattgcagcaggccggttatttgttgaagaa
tccattcatgatgaatttgtgcatcgagtggtagaagaaataaaaaagatgaaaatcggt
gaccccttggacagatccactgaccatgggccccagaatcacaaggcccacttggacaaa
cttctacaatactgtgaaacgggagtgagagaaggagccactttggtatatggaggaaga
caagtccccagacctggcttttttatggagccaactgtgttcacagatgtcgaagaccac
atgtaccttgccaaagaggagtcttttgggcctgttatggtcatttctaaatttaaaaat
ggggatatcgatggagtgttgcaacaagccaataatacagagtatggtctggcttcaggg
gttttcacaagagacataaacaaagctatgtatgtgagtgaaaaattggaagcggggaca
gtcttcattaatacctacaacaagacagatgtggcggccccatttggcggtgtgaagcag
tcaggttttggcaaagatttgggtgaagaggctctccgggagtacctgaaaacaaaggca
gtcactctggaatattag

DBGET integrated database retrieval system