KEGG   Sarcophilus harrisii (Tasmanian devil): 100922499Help
Entry
100922499         CDS       T02286                                 

Gene name
ART3
Definition
(RefSeq) LOW QUALITY PROTEIN: ecto-ADP-ribosyltransferase 3
  KO
K00775  
ADP-ribosyltransferase 3 [EC:2.4.2.31]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100922499 (ART3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:shr00537]
 Enzymes
  100922499 (ART3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
6
AA seq 356 aa AA seqDB search
MHNIPHFHNVYFFLLFXVKGHILSMSTNTFDDQYLKCAARMETKFVPRLLVEEKSNHKLF
HSVWTEAASQWDLKKARLLLPPDFQDNHGIALMAYISQAQGQTPFYQEFSSAVEKAGTSR
DDYIYSFQFKALHFYLTRALQLLSRECSESYRRPAYIKSPFTSSGLRGYDEIRFAHFTSF
SVKPEPLTGSETLFTVYTCFGISTEIISDSGNESILIPLNEVFKLTQEGNRTNFVLRSMN
KTCSHFDCAYLGGLKTENCVDSTGQIKSRYVTFPGLKSKEKEDEITEMDEEQEPVEDPGQ
RSLDYLDNPAPALIPFPSNHPTVASASTSFGEMLLPLFGRFNLLIGTFVVMFFVHL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcataatattcctcatttccacaatgtatattttttcctcctcttttaggttaagggt
catattttaagcatgtctaccaatacttttgatgaccaatacctgaagtgtgctgcaaga
atggaaaccaaatttgttcccagattgctcgttgaggaaaaaagcaaccataagctcttc
cattccgtgtggacagaagcagcatcccaatgggatttaaagaaagcacggctgttgctt
cctccagactttcaggataatcatggaatagcactcatggcatatatttcacaagctcag
gggcagacccccttttaccaagagttcagctctgctgtagaaaaagctggaacatctcga
gatgattatatctacagctttcagttcaaagctttacacttttatctgacaagagcctta
cagcttctgagccgagagtgttcagagagttatagacgtccagcatacatcaaaagccct
tttacttcatctgggcttcgtggatatgatgagatcaggtttgcccattttacctctttc
agtgtcaaacctgaacctttaactggctctgaaacactgttcactgtctacacatgtttt
ggcatttctacagaaataatttctgattcaggaaatgaaagcatcctaatacctctgaat
gaggtttttaaattgacccaggaaggaaatagaaccaactttgtccttagaagtatgaac
aagacctgcagccattttgactgtgcgtaccttggaggcttgaaaacagaaaactgtgtg
gacagcactggacagataaagtccagatatgtcactttccctgggttgaaatccaaagaa
aaagaagatgagatcactgaaatggatgaagaacaagagcctgttgaagaccctggtcag
aggagtctagactatttggacaatcctgctccagctcttattccatttcccagcaaccac
cccactgtggcctctgcttccacctcctttggtgagatgcttcttcccctatttgggagg
tttaatcttttgattggtacttttgttgtaatgttctttgttcatctctga

DBGET integrated database retrieval system