KEGG   Sarcophilus harrisii (Tasmanian devil): 100922603Help
Entry
100922603         CDS       T02286                                 

Definition
malonyl-CoA decarboxylase, mitochondrial-like
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100922603
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100922603
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100922603
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100922603
Enzymes [BR:shr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     100922603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 515 aa AA seqDB search
MRGLGPGLSAQKFLRLRLRSRFLTRPRPRRFGAPGATLERAMDELLGRTVPQAPAYELRE
KTPAPAESQCADFMRFYGSLEGASQRAELLSRLARGFGVDHGQVAEHSAGVLRLGAAVGA
APGPPPGPGVSSLPAPAPREPGALLHAEDRLRYALVPRYRGLFQHISKLEGGVRFLVQLR
ADLLEAQALKIAEGPHVREMNGVLKNMLSDWFSTGFLNLERVTWHSPCEVLQKISECEAV
HPVKNWMDMKRRVSSYRRCYFFSHCSTPGEPLIVLHVALTNEISNNIQAIVKEFSPPETE
DKNKIVTAIFYSISLTQQGLQGVELGSFLIKRVVKELQREFPHLETFSSLSPIPGFTKWL
LGTLSSQTKELGRNELFTDSECNEISDIIGGPISETLKILLTSNEWVKSEKLVKVLQSPL
MRLCAWYLYGEKHRGYALNPVANFHLQNGAVMWRINWLADLSLKGTTSSCGMMVNYRYFL
EETSVNSAAYLGAKNIKASEQVLNLVSQFQKLSKL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcctggggcccggcctgtcagcgcaaaaattcctgcggctgcggctcaggtcc
aggttcctgacccggccacggccgcgacggtttggggcccctggagccaccctagagcgg
gctatggatgaactgctgggccgcaccgtgccgcaagccccggcctatgaactccgggag
aagacgccggcccccgccgagagtcaatgcgcggacttcatgcgtttctacggcagcctg
gagggcgcgagccagcgagccgagctgctgagccgcctggcgcggggcttcggcgtggac
cacggacaggtggcggaacatagcgcgggcgtgctgcgcctcggggcggccgtgggggcc
gcgccgggcccgccgccgggtcccggagtctcctcgttgcccgcgcctgctccgcgagag
cccggcgccctcctccacgcggaggatcggctccgctacgctctggtcccgcgctaccgc
ggcctcttccagcatatcagcaagctggagggcggagtgcgcttcctggtccagctgcgc
gcagacctgctagaggcgcaagccctgaagatagccgaggggccgcacgtccgggaaatg
aatggggtactgaagaacatgctctccgattggttttctacaggatttttaaacctggag
cgtgtaacctggcactcaccttgcgaagtactacaaaaaatcagtgagtgtgaggctgtg
catcctgtcaaaaactggatggacatgaagcgacgtgttagttcatatcgaagatgctat
tttttttctcactgttcaacacctggggaaccactgatagttttgcatgtggcattgacc
aatgagatttccaacaatatccaggcaatagtgaaagagttttctcctccagaaacagaa
gacaaaaacaaaattgtcactgcaattttctattctatcagtttgacccagcaaggccta
caaggtgttgagttgggaagtttccttataaaacgagttgttaaggagctgcagagggaa
tttcctcaccttgaaactttttcaagtctgtcacctatacctggattcaccaaatggctt
cttggaacactgagttctcaaactaaggaacttgggagaaatgaactctttacagattct
gagtgtaatgaaatctcagatatcataggtggtcccattagtgaaactttgaagatactt
ttaaccagcaatgaatgggtgaaatctgaaaaactggtcaaggtattacaatcccctttg
atgagactctgcgcttggtacttatatggagaaaaacatcgtggttatgccctcaaccca
gtggcaaactttcatctgcagaatggggcagtaatgtggaggatcaattggttggcagat
ttgagcctcaaaggcacaacttcatcctgtgggatgatggtcaattatcgatacttcttg
gaagaaactagtgtgaacagtgctgcatacttgggagccaagaatatcaaagcttctgag
caggttctaaatttagtttctcagtttcagaaacttagcaagctttaa

DBGET integrated database retrieval system