KEGG   Sarcophilus harrisii (Tasmanian devil): 100922650Help
Entry
100922650         CDS       T02286                                 

Gene name
KAT2A
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100922650 (KAT2A)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100922650 (KAT2A)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100922650 (KAT2A)
  Infectious diseases
   05166 HTLV-I infection
    100922650 (KAT2A)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100922650 (KAT2A)
Transcription machinery [BR:shr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100922650 (KAT2A)
Chromosome [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100922650 (KAT2A)
   HAT complexes
    PCAF complex
     100922650 (KAT2A)
    STAGA complex
     100922650 (KAT2A)
    TFTC complex
     100922650 (KAT2A)
    SAGA complex
     100922650 (KAT2A)
    SLIK complex
     100922650 (KAT2A)
    ADA-HAT complex
     100922650 (KAT2A)
    HAT-A2 complex
     100922650 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 789 aa AA seqDB search
MARVQAEKDRRSRPVGRARANIAGPGTGKESARSQGTGREATGHPETGDAEGADAECGFS
LLTRQANDACKCNGWKNPKPPTAPRMDLQQPAANLSEACRSCEHPLADHVSHLENVSEDE
INRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEK
PNIEQGVLNFVQFKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQGEDVATY
KVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEK
RTLILTHFPKFLSMLEEEIYGENSPIWESGFTMPASEGPQLVPRPATVSAAAVPSAPLFT
QSLGGSSSSSLGLDPGGAEPMPGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITD
PAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLAPKANRRVLLWLVGLQNVFS
HQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVK
GYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGA
TLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESV
PGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKTHPSAWPFMEPVKKAEAPDYYEV
IRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFK
LKEGGLIDK
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atggcgagggtgcaggctgagaaggaccggcgctcccggccagtgggccgagcgagggcg
aacattgccggcccggggacaggcaaggaaagtgccaggagccaagggaccggccgggag
gccactggccacccggagacaggcgacgccgagggggcggatgctgagtgtggtttctcc
ctccttacccgccaggctaatgacgcttgtaagtgtaacggctggaagaaccccaaacct
cccaccgccccccgcatggacctgcaacagcctgcggcgaacctgagtgaggcctgccgc
agctgcgagcaccccctggctgaccatgtgtcccacctggagaacgtgtctgaggatgag
atcaacaggctgctggggatggtggtggatgtggagaacctcttcatgtctgtacacaag
gaagaagacacagacacaaagcaagtttacttctacctctttaagcttttgagaaaatgc
atcctacagatgacacgtccagtagtggaggggtcgctgggaagtcccccctttgaaaag
ccgaatattgagcagggcgtactgaatttcgtgcagtttaagttcagccacctggctcca
agggagcgacagacaatgtttgaactctcaaagatgttcctgctctgccttaactactgg
aagctagagactcctgcccagttccggcagaggtcacaaggtgaagatgtcgccacctac
aaggtcaattacaccaggtggctttgttattgtcacgtcccacaaagctgtgacagcctg
ccccgttatgagacaactcacgtctttgggcgcagcctccttcgatccatctttactgtt
acccgccgacaactgctggagaagtttcgggtggagaaagacaaactggtgcctgagaag
aggacgcttatccttacccatttccccaagttcttgtccatgttggaggaagagatctat
ggggagaattcccctatttgggaatcaggattcaccatgcctgcctcagaggggccacaa
ttagtgccccggccagccactgtcagtgctgctgctgtgccaagtgccccattattcacc
caaagcctgggtggcagcagcagcagctcccttggtctggaccctggaggggcagagccc
atgccaggtgagaagaggaagcttcctgagaacctgaccctggaagatgcaaagcggctt
cgagtaatgggagacattcccatggaattggtcaatgaggtcatgttgaccatcacagac
cctgcagccatgcttggacctgagaccagcttactctcagccaacgcagcacgggatgaa
actgctcggctagaggaacgtcgtgggatcattgagttccatgtcataggaaattccctg
gcaccaaaggccaatcggcgtgtgctgctctggctagtggggctacagaatgttttttct
caccagcttccccggatgcccaaagagtatattgccaggcttgtgtttgacccgaagcac
aagacattggccctcatcaaagatggacgggtcattgggggaatctgcttccgaatgttc
cccacccagggcttcacggaaattgtcttctgtgcggtcacttccaacgagcaagtcaag
ggatatgggactcacctcatgaaccacctgaaggagtaccacatcaagcacaacatcctc
tacttcctcacctacgcagacgagtatgccattggctacttcaaaaagcagggtttctcc
aaggacatcaaggttcccaagagtcgctacttgggttacatcaaggactatgagggggct
acattgatggagtgtgagctgaatcccaggattccctacactgagctttcccatatcatc
aagaagcagaaagagataatcaagaagctgattgaacgcaaacaggctcagattcgcaag
gtgtacccggggcttagctgcttcaaggagggcgtcaggcagatccccgtggagagtgtc
cctggcatccgtgagacaggatggaagccgctggggaaggagaaagggaaggagctcaag
gaccctgaccagctgtatacaaccctcaaaaacctgctggctcagatcaagacccacccc
agtgcctggcccttcatggagcctgtgaagaaagcagaggctccagattattatgaagtc
atccgtttccccattgacctgaagaccatgactgagcgtctccggagccgctactatgtg
actcggaaactctttgtggctgacctgcagcgggtgatcgccaactgccgggagtacaac
cccccagacagcgagtactgccgctgtgccagcgccctggagaagttcttttattttaag
ctaaaagaaggggggctcattgacaagtag

DBGET integrated database retrieval system