KEGG   Sarcophilus harrisii (Tasmanian devil): 100922650Help
Entry
100922650         CDS       T02286                                 

Gene name
KAT2A
Definition
K(lysine) acetyltransferase 2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:shr04330]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:shr04919]
Human Diseases; Cancers; Viral carcinogenesis [PATH:shr05203]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:shr05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 815 aa AA seqDB search
MAGPRKAPVALDLPKLLHLTRAAPPGEARAQGPRKALREEVGRARANIAGPGTGKESARS
QGTGREATGHPETGDAEGADAECGFSLLTRQANDACKCNGWKNPKPPTAPRMDLQQPAAN
LSEACRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLF
KLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQFKFSHLAPRERQTMFELSKMFL
LCLNYWKLETPAQFRQRSQGEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLL
RSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGENSPIWESGFTMP
ASEGPQLVPRPATVSAAAVPSAPLFTQSLGGSSSSSLGLDPGGAEPMPGEKRKLPENLTL
EDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFH
VIGNSLAPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGG
ICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYF
KKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERK
QAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLA
QIKTHPSAWPFMEPVKKAEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIA
NCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atggccggtccccgcaaggctccagttgctctggatttgcccaagctcctccatctcacc
cgtgctgctcccccgggggaggcgcgggcccaggggcctagaaaagctctccgggaggag
gtgggccgagcgagggcgaacattgccggcccggggacaggcaaggaaagtgccaggagc
caagggaccggccgggaggccactggccacccggagacaggcgacgccgagggggcggat
gctgagtgtggtttctccctccttacccgccaggctaatgacgcttgtaagtgtaacggc
tggaagaaccccaaacctcccaccgccccccgcatggacctgcaacagcctgcggcgaac
ctgagtgaggcctgccgcagctgcgagcaccccctggctgaccatgtgtcccacctggag
aacgtgtctgaggatgagatcaacaggctgctggggatggtggtggatgtggagaacctc
ttcatgtctgtacacaaggaagaagacacagacacaaagcaagtttacttctacctcttt
aagcttttgagaaaatgcatcctacagatgacacgtccagtagtggaggggtcgctggga
agtcccccctttgaaaagccgaatattgagcagggcgtactgaatttcgtgcagtttaag
ttcagccacctggctccaagggagcgacagacaatgtttgaactctcaaagatgttcctg
ctctgccttaactactggaagctagagactcctgcccagttccggcagaggtcacaaggt
gaagatgtcgccacctacaaggtcaattacaccaggtggctttgttattgtcacgtccca
caaagctgtgacagcctgccccgttatgagacaactcacgtctttgggcgcagcctcctt
cgatccatctttactgttacccgccgacaactgctggagaagtttcgggtggagaaagac
aaactggtgcctgagaagaggacgcttatccttacccatttccccaagttcttgtccatg
ttggaggaagagatctatggggagaattcccctatttgggaatcaggattcaccatgcct
gcctcagaggggccacaattagtgccccggccagccactgtcagtgctgctgctgtgcca
agtgccccattattcacccaaagcctgggtggcagcagcagcagctcccttggtctggac
cctggaggggcagagcccatgccaggtgagaagaggaagcttcctgagaacctgaccctg
gaagatgcaaagcggcttcgagtaatgggagacattcccatggaattggtcaatgaggtc
atgttgaccatcacagaccctgcagccatgcttggacctgagaccagcttactctcagcc
aacgcagcacgggatgaaactgctcggctagaggaacgtcgtgggatcattgagttccat
gtcataggaaattccctggcaccaaaggccaatcggcgtgtgctgctctggctagtgggg
ctacagaatgttttttctcaccagcttccccggatgcccaaagagtatattgccaggctt
gtgtttgacccgaagcacaagacattggccctcatcaaagatggacgggtcattggggga
atctgcttccgaatgttccccacccagggcttcacggaaattgtcttctgtgcggtcact
tccaacgagcaagtcaagggatatgggactcacctcatgaaccacctgaaggagtaccac
atcaagcacaacatcctctacttcctcacctacgcagacgagtatgccattggctacttc
aaaaagcagggtttctccaaggacatcaaggttcccaagagtcgctacttgggttacatc
aaggactatgagggggctacattgatggagtgtgagctgaatcccaggattccctacact
gagctttcccatatcatcaagaagcagaaagagataatcaagaagctgattgaacgcaaa
caggctcagattcgcaaggtgtacccggggcttagctgcttcaaggagggcgtcaggcag
atccccgtggagagtgtccctggcatccgtgagacaggatggaagccgctggggaaggag
aaagggaaggagctcaaggaccctgaccagctgtatacaaccctcaaaaacctgctggct
cagatcaagacccaccccagtgcctggcccttcatggagcctgtgaagaaagcagaggct
ccagattattatgaagtcatccgtttccccattgacctgaagaccatgactgagcgtctc
cggagccgctactatgtgactcggaaactctttgtggctgacctgcagcgggtgatcgcc
aactgccgggagtacaaccccccagacagcgagtactgccgctgtgccagcgccctggag
aagttcttttattttaagctaaaagaaggggggctcattgacaagtag

DBGET integrated database retrieval system