KEGG   Sarcophilus harrisii (Tasmanian devil): 100922782Help
Entry
100922782         CDS       T02286                                 

Definition
liver carboxylesterase 1-like
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100922782
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100922782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 563 aa AA seqDB search
MWLLSLVLYFLTTISVQGQQSSTPVVDTQYGKVQGKRESLQGFDKIVNVFLGIPFAKAPL
GPLRFTPPQPAESWDYVKSTTTYPPMCAQDLVSGQLLSDLFTNREEKISLKTSEDCLYLN
IYTPADLSKKSKLPVMVWIHGGGLVVGAASTYDGLALAALEDVVVVAIQYRLGIFGFYST
GDEHARGNWGYLDQVAALQWVQENIANFGGDPGSVTIFGESAGGFSVSALVLSPLTKNLF
HRAISQSGVVLMDCLYNSSLTAATEKITSFAGCKTVTSASMVHCMRQKSEEELLDVGLKM
GLFGLDFLGDPSEKITFLSGVIDGVFFPKSPEELLAEKKFNHIPYIVGINNHEFGWILPT
MMEFPLSQGIPDQETASALLWSSYPLVKIPKDLTATLTKEYLGMTNDPIKKKDLFLNLMG
DLIFGIPSVRLARLHMASGAPTYMYEFQHRPSFSTNLKPEEVKADHGDEIPSVLGAPFLK
EGSLEEEKKLSRIVMKYWANFAKNGNPNGEGLPNWPVYNQNEDYLQINITPKAAKKLKEK
EVKFWTKLMSKELVGVKREHIEL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgctttctctggtcctctattttctcactactatctctgtgcaggggcagcaa
tcctcaacacctgtagtggacactcagtatggaaaagtccaaggcaaacgtgaaagccta
caaggatttgacaaaatcgtcaatgttttcctgggtatcccttttgccaaagctcctctt
ggacccctgagatttactccaccacaacctgcagaatcctgggactacgtaaagagcaca
actacttacccacccatgtgtgcccaggacctagtttctggacaattactttctgacctt
tttaccaaccgggaagaaaaaatttccttgaaaacatctgaagattgtttatacttaaac
atttatacccctgctgacctatcaaagaagagcaagttacctgtgatggtgtggatccat
ggagggggtttggtggtaggtgctgcatcaacctatgatggtctggcccttgcagccctt
gaggatgtcgtagtggtggccattcagtatcgcctgggaatttttggattttatagcact
ggagatgaacatgcccggggaaactggggttacttagatcaagtggctgcacttcagtgg
gtccaggagaacatcgccaattttggaggagacccaggctcagtcaccatctttggggag
tcagcaggaggtttcagtgtttcagcattggttttatctcctttgaccaaaaaccttttc
caccgggctatttctcagagtggagttgtcttaatggattgtctgtacaattccagtctc
acagcagcaactgagaaaattacaagttttgctgggtgcaaaacagtcacttcagccagc
atggttcactgtatgcgacaaaagtcagaagaggaactcctggatgtaggtttgaagatg
ggattatttggtctggatttcctaggagacccttcagagaaaattacttttctatctgga
gtcattgatggagtatttttccctaaaagtcctgaagagcttctggctgaaaagaagttc
aatcatatcccctatattgtgggaatcaacaatcatgaatttggctggattcttccaact
atgatggagttccctctctcacaaggcataccagaccaagaaacagcatcagcattgttg
tggagctcctacccacttgttaaaatccccaaagatcttactgctactttaactaaggaa
tatcttggaatgacaaatgatcctataaaaaagaaggacctgtttttaaacttgatggga
gacttgatatttggaattccttctgtaaggttggctcgacttcatatggcatcaggtgca
cccacatacatgtatgagtttcaacatcgaccaagcttctcaaccaacctaaaaccagag
gaagtgaaggcagatcatggagatgaaattccctctgtcttaggggctccatttttgaaa
gaaggctcactagaggaagaaaagaaacttagcagaattgtgatgaaatattgggccaac
tttgctaagaatggaaaccctaatggagaaggactgccaaactggcctgtttataatcag
aatgaagactacctccaaattaacatcactcccaaagcagccaaaaagctgaaggagaaa
gaagtaaaattttggactaaactcatgtcaaaggaactagttggagtgaagagagaacat
attgagctttaa

DBGET integrated database retrieval system