KEGG   Sarcophilus harrisii (Tasmanian devil): 100923019Help
Entry
100923019         CDS       T02286                                 

Gene name
PAICS
Definition
phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100923019 (PAICS)
Enzymes [BR:shr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     100923019 (PAICS)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     100923019 (PAICS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 421 aa AA seqDB search
MLIKIGKKLYEGKTKEVYELLDNPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCI
FKLLQEAGIKTAFTKKCGDTAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPP
KVELFFKDDANNDPQWSEEQVIAAKWCFAGLNIGQTEVDIMSHSTQAIFEILEKSWLPQN
CTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRTQQKDKQSYRDLKEVTPEGLQM
VKRNFEWVAERVELLHKVQSPCRVVVLMGSTSDLGHCEKIKKACGNYGIPCELRVTSAHK
GPDETLKIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVVNCPPLTPDWGAQDVWS
SLRMPSGLGCSTILSPEGAAQFAAQIFGLNNHLVWAKLRGGMLNTWVSLKQADKKIRECS
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgctgataaagattggtaaaaagctctatgagggtaaaacaaaagaagtctatgaattg
ttggataatcctggcaaagtcctcttgcagtctaaagaccagatcaccgcgggcaacgcc
gctagaaaaaatcatctggaaggaaaagctgctatctcaaacaagattaccagctgtatt
ttcaagttgttacaggaagcaggtatcaaaactgctttcaccaaaaaatgtggtgacaca
gctttcattgcacctcagtgtgaaatgattccaattgaatgggtttgtagaagaattgca
actggttctttcctcaaaagaaatcctggtgtcaaagaaggatacaaattctaccctcct
aaagtggaattgtttttcaaggatgatgccaacaatgatcctcagtggtctgaagaacag
gttattgctgcaaaatggtgttttgctggactgaacataggtcagactgaagtggatatc
atgagtcattccacacaggctatttttgaaatactggaaaaatcctggttacctcagaac
tgtacattggttgacatgaagattgaatttggtgttgatgtgactacaaaagaaattgtt
cttgcggatgttatcgataatgattcttggagactctggccatctggtgatagaacccag
cagaaagacaagcagtcataccgggaccttaaagaagtgactcctgaaggcctccagatg
gtgaagagaaactttgaatgggttgcagaaagagtggagttgcttcataaagtgcaaagt
ccatgcagagttgtggtattgatgggctcaacttctgacctgggtcattgtgaaaaaatt
aagaaagcttgtggaaactatggcattccctgtgaacttcgagtcacatctgcccataaa
ggcccagatgaaactctaaagattaaagcagagtatgaaggagatggtattcctactgtg
tttgtggcagtagctggcagaagcaatggtttggggccagtaatgtctggtaatacagca
tatccagtagtcaactgtcctccccttacacctgattggggagcccaggatgtatggtcc
tcacttcgaatgcctagtggtcttggctgttcgactatactttcacctgaaggagcagct
cagtttgcagcccagatatttggattaaataaccatttggtatgggctaaacttcgagga
ggcatgttaaacacatgggtttccttgaagcaggcggataagaaaatcagagaatgcagt
ttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system