KEGG   Sarcophilus harrisii (Tasmanian devil): 100923319Help
Entry
100923319         CDS       T02286                                 

Gene name
PDIA2
Definition
(RefSeq) protein disulfide isomerase family A, member 2
  KO
K09581  
protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100923319 (PDIA2)
Chaperones and folding catalysts [BR:shr03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100923319 (PDIA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 527 aa AA seqDB search
MRLNSLLLLFLLTVRAWALDGEEGGEAEAEAPEEPTPGPPSDELVEEDDILVLTQHNFAR
ALREHRYLLVEFYAPWCGHCRALAPEYTKAASLLKNESSELKLAKVDGPAEKELVEEFGV
TGYPDLKFFRDGNRSHPVLFTGPREAEGIVRWLKRRLGPSATRLETEAEAAQLIDSQDIV
IIGFFKDLQDEDAAAFLAIAEDAVDLTFGLTDRPELFQKYGLSKDTVVLFKKFDEGRADF
PVDEELGLDQADLSHFLVVHSMHLVTEFNSQTSSKIFEVRILNHLLLFINQTLSPHKELL
TGFQEAAPLFRGEVLFVVVDVAGENDHVLQYFGMNATDAPTLRFINVETTKKYVPNTGEI
TAASVTAFCQDVLSGKIKPHLRSQEIPADWDQKPVKVLVGKNFEQVVFDESKKVFVKFYA
PWCTHCKEMAQTWEDLAEKYKDHEDIIIAELDSTANELEAFAIRGFPTLKYFPAGPGRKV
IEYKSARDLETFSKFLDNDGVLPEPENPEVPLPEAGTNESKGHKDEL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgagactaaactccctccttctgctctttttgctcactgtaagggcctgggccctggat
ggggaggaggggggggaggcggaggccgaggctccggaagagcccaccccgggacccccc
tctgatgaactcgtggaggaggacgacatcttggtcctcacccagcacaactttgctcgg
gctctacgggaacaccgctacctgctggtggaattctatgccccctggtgtgggcactgt
agggctctggcccctgaatataccaaagcggcatccttgttgaagaatgaatcctcagag
ctgaagctggccaaggtggatggccctgcggagaaggagctggtggaagagtttggggtg
actgggtaccccgacctcaagttcttccgagatggaaacagatcccaccctgtgctgttt
acaggcccacgggaggccgagggcatcgtccgttggctgaagcgacgtttggggcccagt
gccactcggctggagactgaggctgaagccgcacaactcattgattcccaggacattgtc
atcattgggttcttcaaggacctccaggatgaagatgcggctgcgtttctggccattgcc
gaggatgctgtggatttgacctttggtctcaccgatcgaccagagcttttccagaaatat
ggcctgagcaaggacacggtggtcctcttcaagaagtttgacgagggccgtgcagatttt
cccgtggatgaggagctaggattggaccaagcagatctctctcatttccttgttgtgcat
agcatgcacctggtcacagaattcaacagccagacatcctccaagatctttgaggtcagg
atcctcaaccaccttctgctcttcatcaatcagacgcttagcccacacaaggagcttctg
acaggtttccaggaggctgcccctcttttcaggggagaagtcttgtttgtggtggtggat
gtggccggagagaatgaccacgtgctgcagtactttggcatgaacgccacagatgccccc
actctgcggtttatcaatgttgagaccaccaagaagtacgtgcccaacaccggagagatc
acggccgcctctgtcaccgccttctgccaagatgtcctgagtggcaaaatcaagccccac
ctccggagtcaggagatcccggccgactgggaccagaaacctgtcaaggtccttgtaggg
aagaactttgagcaagtagtctttgatgagtccaagaaggtgtttgtgaagttctatgcc
ccatggtgtacccactgtaaggagatggcccagacctgggaggacctagcagagaaatac
aaagaccatgaggacatcatcattgcagaacttgactccacagccaatgaactggaggcc
tttgccatccggggcttccccacccttaaatatttcccagctgggccaggccggaaggtg
atcgagtataaaagtgccagggacttggagaccttctccaaattcttagacaatgatggt
gtcctgccggaaccagagaaccctgaggtccccctcccggaggctggaaccaatgagagc
aaaggacacaaagatgaattgtag

DBGET integrated database retrieval system