KEGG   Sarcophilus harrisii (Tasmanian devil): 100923319Help
Entry
100923319         CDS       T02286                                 

Gene name
PDIA2
Definition
(RefSeq) protein disulfide-isomerase A2
  KO
K09581  protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100923319 (PDIA2)
Chaperones and folding catalysts [BR:shr03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100923319 (PDIA2)
Membrane trafficking [BR:shr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100923319 (PDIA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_7 OST3_OST6 Thioredoxin_8 AhpC-TSA Redoxin P22_portal Thioredoxin_4
Motif
Other DBs
NCBI-GeneID: 100923319
NCBI-ProteinID: XP_012398661
Ensembl: ENSSHAG00000003557
Position
2
AA seq 605 aa AA seqDB search
MHLVEIVPRLPPCPAPLSLRAWPQPQPIPLWPCLIFAPAPGTGAQQPPRGSRSLAVPPRY
LPPPPSLGHRHQAALLPTMRLNSLLLLFLLTVRAWALDGEEGGEAEAEAPEEPTPGPPSD
ELVEEDDILVLTQHNFARALREHRYLLVEFYAPWCGHCRALAPEYTKAASLLKNESSELK
LAKVDGPAEKELVEEFGVTGYPDLKFFRDGNRSHPVLFTGPREAEGIVRWLKRRLGPSAT
RLETEAEAAQLIDSQDIVIIGFFKDLQDEDAAAFLAIAEDAVDLTFGLTDRPELFQKYGL
SKDTVVLFKKFDEGRADFPVDEELGLDQADLSHFLVVHSMHLVTEFNSQTSSKIFEVRIL
NHLLLFINQTLSPHKELLTGFQEAAPLFRGEVLFVVVDVAGENDHVLQYFGMNATDAPTL
RFINVETTKKYVPNTGEITAASVTAFCQDVLSGKIKPHLRSQEIPADWDQKPVKVLVGKN
FEQVVFDESKKVFVKFYAPWCTHCKEMAQTWEDLAEKYKDHEDIIIAELDSTANELEAFA
IRGFPTLKYFPAGPGRKVIEYKSARDLETFSKFLDNDGVLPEPENPEVPLPEAGTNESKG
HKDEL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgcacctggtggagattgtcccaaggctgcccccttgcccagccccacttagtctcagg
gcctggccccagccccaaccaattcctctatggccgtgccttatctttgcacctgcacct
ggtactggggcccagcaaccgccacgtggcagcaggtccttggctgtcccccctcgttat
ctgcccccacccccctccctggggcacagacaccaggcggcattgctcccaaccatgaga
ctaaactccctccttctgctctttttgctcactgtaagggcctgggccctggatggggag
gaggggggggaggcggaggccgaggctccggaagagcccaccccgggacccccctctgat
gaactcgtggaggaggacgacatcttggtcctcacccagcacaactttgctcgggctcta
cgggaacaccgctacctgctggtggaattctatgccccctggtgtgggcactgtagggct
ctggcccctgaatataccaaagcggcatccttgttgaagaatgaatcctcagagctgaag
ctggccaaggtggatggccctgcggagaaggagctggtggaagagtttggggtgactggg
taccccgacctcaagttcttccgagatggaaacagatcccaccctgtgctgtttacaggc
ccacgggaggccgagggcatcgtccgttggctgaagcgacgtttggggcccagtgccact
cggctggagactgaggctgaagccgcacaactcattgattcccaggacattgtcatcatt
gggttcttcaaggacctccaggatgaagatgcggctgcgtttctggccattgccgaggat
gctgtggatttgacctttggtctcaccgatcgaccagagcttttccagaaatatggcctg
agcaaggacacggtggtcctcttcaagaagtttgacgagggccgtgcagattttcccgtg
gatgaggagctaggattggaccaagcagatctctctcatttccttgttgtgcatagcatg
cacctggtcacagaattcaacagccagacatcctccaagatctttgaggtcaggatcctc
aaccaccttctgctcttcatcaatcagacgcttagcccacacaaggagcttctgacaggt
ttccaggaggctgcccctcttttcaggggagaagtcttgtttgtggtggtggatgtggcc
ggagagaatgaccacgtgctgcagtactttggcatgaacgccacagatgcccccactctg
cggtttatcaatgttgagaccaccaagaagtacgtgcccaacaccggagagatcacggcc
gcctctgtcaccgccttctgccaagatgtcctgagtggcaaaatcaagccccacctccgg
agtcaggagatcccggccgactgggaccagaaacctgtcaaggtccttgtagggaagaac
tttgagcaagtagtctttgatgagtccaagaaggtgtttgtgaagttctatgccccatgg
tgtacccactgtaaggagatggcccagacctgggaggacctagcagagaaatacaaagac
catgaggacatcatcattgcagaacttgactccacagccaatgaactggaggcctttgcc
atccggggcttccccacccttaaatatttcccagctgggccaggccggaaggtgatcgag
tataaaagtgccagggacttggagaccttctccaaattcttagacaatgatggtgtcctg
ccggaaccagagaaccctgaggtccccctcccggaggctggaaccaatgagagcaaagga
cacaaagatgaattgtag

DBGET integrated database retrieval system